SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP010024-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP010024-PA
Domain Number 1 Region: 357-380
Classification Level Classification E-value
Superfamily DPY module 0.0000017
Family DPY module 0.00089
Further Details:      
 
Domain Number 2 Region: 463-486
Classification Level Classification E-value
Superfamily DPY module 0.00000183
Family DPY module 0.0015
Further Details:      
 
Domain Number 3 Region: 572-595
Classification Level Classification E-value
Superfamily DPY module 0.00000327
Family DPY module 0.00089
Further Details:      
 
Domain Number 4 Region: 40-63
Classification Level Classification E-value
Superfamily DPY module 0.00000392
Family DPY module 0.0015
Further Details:      
 
Domain Number 5 Region: 676-699
Classification Level Classification E-value
Superfamily DPY module 0.00000392
Family DPY module 0.0015
Further Details:      
 
Domain Number 6 Region: 1192-1214
Classification Level Classification E-value
Superfamily DPY module 0.0000051
Family DPY module 0.0013
Further Details:      
 
Domain Number 7 Region: 151-310
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000534
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 8 Region: 1104-1126
Classification Level Classification E-value
Superfamily DPY module 0.00000915
Family DPY module 0.0013
Further Details:      
 
Domain Number 9 Region: 997-1020
Classification Level Classification E-value
Superfamily DPY module 0.000034
Family DPY module 0.0016
Further Details:      
 
Domain Number 10 Region: 779-802
Classification Level Classification E-value
Superfamily DPY module 0.0000523
Family DPY module 0.0024
Further Details:      
 
Domain Number 11 Region: 1505-1527
Classification Level Classification E-value
Superfamily DPY module 0.0000876
Family DPY module 0.0016
Further Details:      
 
Weak hits

Sequence:  AGAP010024-PA
Domain Number - Region: 1565-1588
Classification Level Classification E-value
Superfamily DPY module 0.000131
Family DPY module 0.0024
Further Details:      
 
Domain Number - Region: 537-634
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00022
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number - Region: 1382-1405
Classification Level Classification E-value
Superfamily DPY module 0.000235
Family DPY module 0.0016
Further Details:      
 
Domain Number - Region: 1694-1716
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 887-910
Classification Level Classification E-value
Superfamily DPY module 0.000392
Family DPY module 0.0022
Further Details:      
 
Domain Number - Region: 2332-2354
Classification Level Classification E-value
Superfamily DPY module 0.000484
Family DPY module 0.0025
Further Details:      
 
Domain Number - Region: 2077-2100
Classification Level Classification E-value
Superfamily DPY module 0.00288
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 1259-1282
Classification Level Classification E-value
Superfamily DPY module 0.00432
Family DPY module 0.0038
Further Details:      
 
Domain Number - Region: 792-945
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00565
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 2401-2422
Classification Level Classification E-value
Superfamily DPY module 0.00667
Family DPY module 0.0026
Further Details:      
 
Domain Number - Region: 2152-2172
Classification Level Classification E-value
Superfamily DPY module 0.00902
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 2519-2539
Classification Level Classification E-value
Superfamily DPY module 0.0112
Family DPY module 0.0036
Further Details:      
 
Domain Number - Region: 1324-1344
Classification Level Classification E-value
Superfamily DPY module 0.0144
Family DPY module 0.0027
Further Details:      
 
Domain Number - Region: 2011-2034
Classification Level Classification E-value
Superfamily DPY module 0.0157
Family DPY module 0.0051
Further Details:      
 
Domain Number - Region: 1830-1851
Classification Level Classification E-value
Superfamily DPY module 0.0157
Family DPY module 0.0039
Further Details:      
 
Domain Number - Region: 424-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0226
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 2209-2229
Classification Level Classification E-value
Superfamily DPY module 0.0301
Family DPY module 0.0044
Further Details:      
 
Domain Number - Region: 2581-2602
Classification Level Classification E-value
Superfamily DPY module 0.0301
Family DPY module 0.0044
Further Details:      
 
Domain Number - Region: 1894-1916
Classification Level Classification E-value
Superfamily DPY module 0.0458
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 1952-1973
Classification Level Classification E-value
Superfamily DPY module 0.0471
Family DPY module 0.004
Further Details:      
 
Domain Number - Region: 2269-2290
Classification Level Classification E-value
Superfamily DPY module 0.051
Family DPY module 0.0038
Further Details:      
 
Domain Number - Region: 105-138
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0527
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP010024-PA   Gene: AGAP010024   Transcript: AGAP010024-RA
Sequence length 3202
Comment pep:novel chromosome:AgamP3:3R:47930147:47941811:1 gene:AGAP010024 transcript:AGAP010024-RA
Sequence
PEPVNDDPCNPSPCGANAQCQNGICTCLPEYQGDPYRGCRPECVLNSDCARDRACIRSKC
VDPCPGTCGQDALCEVINHIPMCRCPDGMAGNAFVQCRPQQAPVVTNPCSPSPCGPNSQC
REINGQAVCSCVPGYIGSPPTCRPECVVSAECPQNQACTNQKCRDPCPGTCGVGARCSVV
NHNPICSCPERYTGDPFVRCQPMIEPPVQMTPSNPCQPSPCGPNAQCRAVGDSPSCTCIE
GMIGAPPNCRPECISNSDCSNNLACIRQKCQDPCPGACGANAECRVVSHTPMCICAVGYT
GDPFTQCVPFQQDTPKDQTTPCLPNPCGANAQCREQNGAGACTCIEDHFGNPYEGCRPEC
VLNSDCPSNRACVRNKCQDPCPGTCGQNADCQVVNHLPSCTCFPGYEGDPFRYCNIQQRE
PVQEYVNPCQPSPCGPNSQCREVNGQAVCSCLPTYVGSPPGCRPECVVSSECALDKACVN
QKCVDPCPGTCGTNARCNVNNHSPICSCQSGFTGDPFTRCYPIPPPVQDTPIVVRNPCVP
SPCGPNSQCRDVNGSPSCSCLINYIGSPPNCRPECTINAECPSNQACMNEKCRDPCPGSC
GINARCNVINHTPICTCEEGYTGDPFTSCRPMPPPPPEPVNDDPCNPSPCGANAQCQNGI
CTCLPEYQGDPYRGCRPECVLNSDCARDRACIRSKCVDPCPGTCGQDALCEVINHIPMCR
CPDGMAGNAFVQCRPQQAPVVTNPCSPSPCGPNSQCREINGQAVCSCLSGYFGSPPMCRP
ECTGNSECLLSLACINFKCADPCPGSCGFAARCTTVNHNPICTCPPKMTGDPFTRCYEIA
EKSPPLNIPADPCQPSPCGPNALCANNNGVPSCSCQPEMVGSPPNCRPECTSHSDCSRVQ
ACSKQKCVDPCLNACGSDARCHVSLHVANCFCPDRYEGDPFRACTLKITTPPPQAEPRDP
CYPSPCGVNARCRPANGETAICECIENYFGNPYESCRPECVANGDCQKSLACINNRCKDP
CPGVCGRNAECAVVNHTPVCSCPDGMKGNAFEQCLREEVTPPPSDPCYPSPCGQNTVCRV
FNGNAVCECLPEFKGSPFGRGCYPECVINSDCPRDRTCVNKKCVDPCPGVCGYRAECHAI
NNSPVCSCPRDMIGDPFVECKLAPPKDLCNPSPCRTNGICRVVADRAECQYPECIINSDC
STNRACYNQRCQDPCVGACGINALCSVINHSPVCSCPARHAGSPFVQCVPQRDEPQQPQP
ECTSDGQCTNDKACIGGQCQNPCTVSTGLCTQNAECRVQFHRAICACREGYTGNAQLACY
EIGCRSDSDCPATEACVNKNCIDPCRHTQCGRNAYCKSDYNHNARCHCMDGYRGNPLVGC
TRPECTSNDECPYHQSCQNEQCRDPCNCAPNAQCRVDNHQANCRCPPGYTGDPLFSYEPG
CYSDVECAPTESCRARVCVDVCSDYNPCASSAECLAQSHKAICSCPVGTVGDPFQNCYKP
PVVSPECVVDADCSSSMACVNERCQDPCAGSNPCGGNAECRAVYHRPHCTCPIGWGGDPK
TQCYKPECKIDAECPFDKACFNEKCISPCTYGATQCGRGADCVAQSHRAVCICPLGTQGN
PFVSCVTGMCQYNEDCAEHEACDRLNRVCRPVCDDETCARTATCVARNHQASCECAPGMR
GNPYVECMRDVPEPECRMDSECGSQQACIRNRCVNPCTELTPCASQQKCSVIDTLPLRTI
ICACQTDMLMDRSGSCKPIVIEECRLDSDCADTDRCLRGQCVEACKADPCGINAQCASAN
HRAQCTCSPGYVGNAHIECLPEPRVTSPKECAADDDCSDDRACFNDRCVNPCVSDACGRG
ALCRTSNHKAVCNCPSGYTMDGNGNCIPPAGDLPRCRSNSDCTRSETCVNEICANPCNCG
QNADCFVKDHYPVCSCRPGYSGNAQTGCFKLECQADSDCTNDKQCTNGACVDPCLYQNPC
ALNAECYGDRHRAACRCLPGLEGNPFERCRRVECHYDGECAKTLACQQEQCVDPCANSPC
AQNAQCFVSNHQAQCKCPEQMPEGNPYSFCRPRAVEREECRVDGDCPSRMACIGNRCLNP
CDELRPCAASALCTVQDSVPVRTMVCECPPLHVPDSAGECRRIVLQTPVGVCTTDSECSE
QEACINRQCRDPCSCGSNAICMIKNHRAVCSCEDGYEGNPNVACRAIGCRVDSECETSKA
CVNGNCVNPCLDHNPCGIGAECFGRANRAECRCLSGYRGNPLVQCNVVECRSNNDCPDDK
QCRNAQCVNPCIYENSCSPRAECRAQNHLVVCRCPVGLVGNPYVDCRPEVVPECQYDTDC
PGHLACIDNKCTEPCSALTPCNQPARCEVVPSSPVRTMLCTCPDGYVSSGSGTCKPVVKA
GCISDSDCSSDTACINSICRDPCNCGPNAECRVKDHKPVCSCAQGYDGDPETQCIKIECR
SDSDCSGQHTCYNRQCVPACSMESCGTQAECIGVNHRAVCECVPGYEGNPKVACKLIGCR
RDSDCPLDKACINGQCGNPCELQAVCAQNEQCQVYQHRPECACPPPFENDPLQGCVLRDD
RCMTDGECPSQTACIQGECVNPCNVTEPCGVNSNCKVLDTLPVRTMICECLPGYQGNAAI
QCDKMALCPTDRGFVRNSNGECVCPPGYGLSLYDDCQPCREEDGLKVDETGRCVCALERG
LIIDERGRCICPIEYGYRLTSRGECIRSEKPECERDEHCADWRYCNLESKTCDDPCQRKI
CGTNALCNATNHQAVCQCITGYTGNPEEHCNQTTNFRTDFPQPEMVVTCQADGVQVVIDL
AESNFNGVLYVKGHSKDEECRRVVNLAGDTSSARTQIFKVHFGSCGLIHVNGIASFVLVI
QKHPKLVTYKAQAYHIKCVYQTGEQNVTLGFNVQMLTTAGTIANTGPPPTCAMRIVAFNG
EEINSAEIGDNLRLQVEVQPATIYGGFARSCVAKTMEESVENEYIVTDEDGCATDPSIFG
DWEYNAETNSLLASFNAFKFPSSDNIRFQCNIRVCFGKCQPVNCHGANAYGKRRRRREAL
GIDMMSTIEVVYNRTKRAADDTALATDDSLGMEGTLREEITIQSNAILTLEKREERSYDS
NNITPAAQRVEDICVSMIGLILALVITALLALVAVAVAVSCWLMAYRRRPTITGPLPHPP
EFPNPLFAHHEPSEPSHHDFMG
Download sequence
Identical sequences Q7Q112
7165.AGAP010024-PA AGAP010024-PA|hypothetical AGAP010024-PA XP_319172.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]