SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP010233-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP010233-PA
Domain Number 1 Region: 134-378
Classification Level Classification E-value
Superfamily vWA-like 2.97e-70
Family Integrin A (or I) domain 0.00000157
Further Details:      
 
Domain Number 2 Region: 30-80
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000199
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 644-723
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000811
Family Integrin beta tail domain 0.0031
Further Details:      
 
Domain Number 4 Region: 560-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000148
Family Integrin beta EGF-like domains 0.018
Further Details:      
 
Domain Number 5 Region: 609-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000173
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Domain Number 6 Region: 362-470
Classification Level Classification E-value
Superfamily Integrin domains 0.0000183
Family Integrin domains 0.009
Further Details:      
 
Weak hits

Sequence:  AGAP010233-PA
Domain Number - Region: 532-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000209
Family Integrin beta EGF-like domains 0.021
Further Details:      
 
Domain Number - Region: 479-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00698
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP010233-PA   Gene: AGAP010233   Transcript: AGAP010233-RA
Sequence length 803
Comment pep:known chromosome:AgamP3:3R:51329079:51332606:1 gene:AGAP010233 transcript:AGAP010233-RA
Sequence
MTAFKISVTLLVTTYLLSLAFGQSSRVVTQSKCFFQKNCIECLDADKDCAWCTDELYDMR
KSRCMTKHELLESKCNALKIETNDDYSFLQIGKNEPHRDFDSQQLEAVQIMPQKMNLRLG
KLGSRTISFKYKPAKNYPLDMYYLMDLTWSMRDDKATLESMGSQLALALANLTANYQLGF
GSFADKPAFPFIQSEPHRLQNPCYSENDQCEPTYGFKHRLKITRDIDSFIAQVKESNVTG
NVDNLEAGLDALMQVLVCEKQIGWGSNTRKIVIVATDGWLHMAGDGLLAGIVEENDKQCH
LDSDGNFVDALKYDYPSLEQIWRVLLRSKTAVIFAVTEAQQAYYRRLSDLMPEFTSVGRL
QDDSSNIIQLVDEGYREFVKRVEFIDNSPDYMQLRYTTDCAGLYREPQPINRCDNIEIGK
EYKFNVEIHLLEYPKDPSITNVTVRIEEKLISNEAVELDIDLRTSCNCEKNKKPMELSEL
CNFNGDYVCGQCQCYVGWIGKTCECNLQNSQNRRELFEQCVAPSVGDELRTGPICSDRGE
CICGQCYCNPGFEGEHCECNECATIDGSICGGPDHGICTCGTCSCFDSWSGDNCECTTDT
TGCKAPSNDAVCSGHGQCNCGRCSCDESFFGPFCETKDGEQPALCSSYEDCIRCAVHEIN
NIPCQDLDNKCREKIGLYKVQLVDATDNSLNCTFRFSDEKNVCDYRFSYELANNRETLLK
VQNLQCKEINLIAAGFTIAASIIIGGLLMLFCYRCKIMYDDRKMFAKFEKEREQETKYQM
ESPLYKSPISNFKVPAEMETSVL
Download sequence
Identical sequences Q7PME7
AGAP010233-PA 7165.AGAP010233-PA XP_319420.1.40869 AGAP010233-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]