SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP010265-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP010265-PA
Domain Number 1 Region: 435-559
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000361
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 318-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000519
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 279-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000201
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 367-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000689
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  AGAP010265-PA
Domain Number - Region: 181-321
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00659
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP010265-PA   Gene: AGAP010265   Transcript: AGAP010265-RA
Sequence length 660
Comment pep:novel chromosome:AgamP3:3R:51820780:51843498:1 gene:AGAP010265 transcript:AGAP010265-RA
Sequence
MNWIYILACIYVSSQFLLLKVAGSGLFELELRYFQNEKSIDHNEKCCSEKADAQGRCIGT
CKTRFRACLKHYQATIDTTSPCTFGDVITPVLEGTTLNFTAISGAKEGFTNPIRFPFEFG
WPGYFTLIIEAWHDTNETTTRSPGTLISRLSIQRILEVSADWMEDSYNSSHTMIRYAFRV
TCDPNYYGAGCANLCRKRDDQFGHYTCSPIGERVSQCTPGCLHGHCNKPNECICQSGWKG
PLCDECEPYPGCLHGTCKKPWECICKEGWGGLFCNQDLNYCTNHKPCLNGGTCFNTGQGL
YTCQCRPGYKGTECELSITSCSDHPCLHGATCTSTVDGETSMDADGRKYQCHCAKGWMGR
HCEREAITCAEKPCHQGTCVDVTPSSSSSSSTSANFRCDCPPGYSGTACEIKSGECYSNY
CANGGTWIGMLMCLCPDGFVGDRCEENVDDCVGNLCLNGGTCVDADNHFKCQCVPGFIGT
HCEEKVDLCLTKPCANGGICTNLENDYRCQCRAGFTGKDCSADVDECHSAPCRNGGTCIN
RVNSYQCVCAGGYRGHSCEEESATVIQRDADIEGSEFHHHHHHPQQQQRHSGGEGVDSSS
RTADGLSSGQIVLIAMFSISTPLLAFIATTIVICLKRKRQREQEKDDAEARKQNEQNASH
Download sequence
Identical sequences Q7Q0M5
XP_319454.4.40869 AGAP010265-PA 7165.AGAP010265-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]