SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP010548-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP010548-PA
Domain Number 1 Region: 29-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000011
Family I set domains 0.026
Further Details:      
 
Weak hits

Sequence:  AGAP010548-PA
Domain Number - Region: 324-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family EGF-type module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP010548-PA   Gene: AGAP010548   Transcript: AGAP010548-RA
Sequence length 377
Comment pep:novel chromosome:AgamP3:3L:6175022:6176322:-1 gene:AGAP010548 transcript:AGAP010548-RA
Sequence
FCLIQILLRSNSVLFSSDSEDVSLEYETTPTFDVVIAEGKKLKLKVHDYGHRPLCNPVWY
FNGRPVSKSRCIPSYGELVCPSVKREDAGRYDLWGGDGSRHSQARLIFSANVQVTRAVER
DLPEERIAKVQDEPPPFFERKNRVENDCFCSGVTERCRMALDLYRMRKTYDLSNLTAVRL
GGESSGANYIRIPLSVLLGNLITAYGGYMRFPVTEECYTDRSKPCVVMVDKRNMHRAVGY
FLPTSHDQRQVQVLLKESNWKLLPAIDELSDRDSGDELTKFIFMSTLSNIHSVYIRGRYR
TRSEENILSIDMASSYDEGLGTVTTVEECDCHPGYGGLSCERCEKGYLRTYDSISPEGIC
LSIPELWELHKKIYRQN
Download sequence
Identical sequences Q7Q8V0
AGAP010548-PA XP_314518.3.40869 7165.AGAP010548-PA AGAP010548-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]