SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP011034-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP011034-PA
Domain Number 1 Region: 1009-1227,1258-1352
Classification Level Classification E-value
Superfamily NHL repeat 7.06e-17
Family NHL repeat 0.0063
Further Details:      
 
Weak hits

Sequence:  AGAP011034-PA
Domain Number - Region: 701-778
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000384
Family Pre-dockerin domain 0.059
Further Details:      
 
Domain Number - Region: 451-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000481
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 551-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00879
Family Integrin beta EGF-like domains 0.072
Further Details:      
 
Domain Number - Region: 420-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0123
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 355-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.018
Family EGF-type module 0.098
Further Details:      
 
Domain Number - Region: 384-410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family EGF-type module 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP011034-PA   Gene: AGAP011034   Transcript: AGAP011034-RA
Sequence length 2580
Comment pep:novel chromosome:AgamP3:3L:15299371:15318611:1 gene:AGAP011034 transcript:AGAP011034-RA
Sequence
INNKGSPIDYKTGSACSTPTKDTLKSYDRNCMGPVLPPRSTMCGPPAHHYSAPLNFRKGF
TFTKCTWKCTAILVILLSVILVITLLLTASNVLSISYPTTNPCTVLVDEKAEISAAKSTI
ADANRAGIPGGGGDGLGLDQSALAPSASGRPKSIAADESSPGGSASGSSSLSAASTAATG
KAAGTGGTAGTGTVPDKQTVASLRSVELLHAVADSARTFPARSFPPDGTTFSQITLGQRL
SKEIPPYSYWNMQFYQSEPAYVKFDYSIPRGASIGVYARRNALPTHTQYHFKEVLSGFNA
RQTRATHPSMRREVTRYMEPGHWFLSIYNDDGDAQDIAFYAVVAEDMTQNCPNGCSGNGQ
CLLGHCQCNPGFGGDDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHDECEVPDC
NGHGHCVSGKCGCVRGYKGKYCEEVDCPHPTCTGHGFCAEGTCICKKGWKGPDCATMDQD
ALQCLPDCSGHGTFDLDTQTCTCEPKWSGEDCSKELCDLNCGQHGRCVGETCSCDAGWGG
EYCNNKLCDPRCNEHGQCKNGTCLCVTGWNGKHCTLEGCPSGCSQHGQCHVSGELMWECR
CYEGWDGADCSVPLEQNCGDNKDNDRDGLVDCEDPECCGSHSCKTSQLCVSAPKPIDVLL
RKQPPAITASFFERMKFLIDEGSLQNYAKLETFNESRSAVIRGRVVTSLNMGLVGVRVST
STPLEGFTLTRDDGWFDLMVNGGGAITLQFGRSPFRPQTRIVQVPWNEVVIIDTVVMSTS
DDKSHHGPPHTCFSHDYDLMKPVVLATWKHGFQGACPDRSAILAESQVIQESLAIPGTGL
NLVYHSSRAAGYLSTIKLQLTPDVIPPTLKLIYLRITIEGILFERVFEADPGIKFTYPWN
RLNIYRQRVYGITTAVVKVGYQYTDCKDVVWDVQTTKLSGHDMSISEVGGWNLDIHHRYN
FHEGILQKGDGSNIYLKHKPRVILTAMGDGHQRPLECGDCNGVATKQRLLAPVALAAAPD
GSLYVGDFNYIRRIMIDGTVRTVVKLNATRVSYRYHMALSPLDGSLYVSDPESHQIIKVR
NKDDTHDPDHNWEPVVGSGERCLPGDEAHCGDGGLARDAKLAYPKGVAISSDNILYFADG
TNIRMVDRDGVISTLIGNHMHKSHWKPVPCEGTLKIEEMHLRWPTELTINPLDDTLHIID
DHMILRMTPDGRVRVIAGRPMHCATAGGSGTGVSTGVSGASSVASLSYDTDLAIHATLVM
PQSIAFAPSGDLYVAESDSQRINRIRVIGTDGKISPYAGAESKCNCLERGCDCYEADHYL
AISAKFNTISAITVTPDGHVHIADQANYRIRSVISSLPEAGTSKEYEIYAPNAQEIYVFN
RFGQHIATKNIMTGETVYSFLYNVNTSNGKLSTVTDAAGNKVFLLRDYTSQVNSIENTKG
QKCRLRMTRMKMLHELNTPDNYNVTFEYHGPTGLLKTKLDSTGRSYVYNYDEFGRLTSAV
TPTGKVIDLTFDLSVQGATVKVTENSQREVSMLIQGSSVVSKVGEAATKTTVMLDGGTTS
VSPWGNAVSVESVPYVLLAEVDPLLGESYPVPSKQRTEINGDLSNRFEWRYFIRHVPVRG
KNARTLTQVGRKLRVNGENLLTFEYEKDTSSITVSVDDKTELLNVTYDKSSRPIAYRPQS
GEYADVDLEYDRFGRLISWKWGNLKEEYTFDRAGRLNEIKYGDGSSIVYAFKDTFSSLPL
KVTTPRRSDYLLQYDDAGALQSLTTPRGHIHAFSLQTSLGFFKYQYYSPINRHPFEILYS
DEGQILAKIHPHQSGKVAFVHDSAGRLETILAGLSSTQYTYQESTSLVKQVEVLEPGFEL
RREFKYHAGVLKDEKLKFGSKSGLASAHFKYQYDGNARLSGIEMDVNGKELPIVRFKYGP
AQGTLDAVSDLRITRNAFNRTVVQDTSKQFFTITDFDEHGRVKSVLINIKSFDVYRLELD
YDLRNRIRTHKVMVGRSTSLDKVNYNADGHVMEVVGTNSWKYVYDENGNIIGILEQGDKT
NLGYDTGDRVVQVGDVEFNSYDARGYVVRRGEQKYRYNNRGQLIHAMERDRFQTWYFYDD
LGRLVACHDEKGNVTQYFYANLNAPELITHIHYPKAGRTSRLLYDDRHMLIAIETGDQRY
YVATDQNGSPIALFDVGGAIVKEIRRTPFGKIVKDTNPGLFVPIDFHGGLLDPNTRLVYM
EQRLYDTGVGQWMTPAWEQLATEMRHPTDVFIYRFHNNDPINRREPEGNYMNDLRSWLKL
FGYDVTKMQGSRYTRDMIYRPTATIKSPQLAPDFGVMSGLQCIVEKVDEKFADFGFIPKP
LLKMELKTRNLLPRVAYRRGVFGEGVLISRIDGRALVSVVDGSNSVVQDVVSSVFNNSHF
LDLHFSIHDQDVFYFVKDNVMKLRDDTEELRRLGGMFNISAHEINDHGGANGKELRLHGP
DAVVIIKYGVDPEQERHRILKHAHKRAVERAWELEKQLVAAGFQGRGDWTEEEKEELISH
GDVDGWIGVDIHSIHKYPQLADDPGNVAFQRDSKRKRRKSGGTSSGGGGGGHKAKREHRH
Download sequence
Identical sequences Q7QK12
7165.AGAP011034-PA XP_308102.4.40869 AGAP011034-PA|hypothetical AGAP011034-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]