SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP011527-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP011527-PA
Domain Number 1 Region: 89-173
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-16
Family Cadherin 0.0036
Further Details:      
 
Domain Number 2 Region: 8-82
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000228
Family Cadherin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP011527-PA   Gene: AGAP011527   Transcript: AGAP011527-RA
Sequence length 180
Comment pep:novel chromosome:AgamP3:3L:26543311:26551470:-1 gene:AGAP011527 transcript:AGAP011527-RA
Sequence
MAQFCDSKVLATDQDIGENGRVTYSIKPGRGKAKKFRIDPDTGVIYAARTFEIDTEYDLL
VRAEDHGVPKRSQQARVVVAVVGVPLESENAPVVKTGDQHVEVTESDAPGYLVTLIQASD
ADGEQVWYDIVGGDERHEFYIGRDNGNVLLAKYLDWERQREYNITISISDGSTSTVQQIT
Download sequence
Identical sequences A0A1W5C9C3
AGAP011527-PA|hypothetical XP_001230523.2.40869 7165.AGAP011527-PA AGAP011527-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]