SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP011528-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP011528-PA
Domain Number 1 Region: 45-181
Classification Level Classification E-value
Superfamily Cadherin-like 7.48e-32
Family Cadherin 0.0009
Further Details:      
 
Domain Number 2 Region: 8-56
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000828
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP011528-PA   Gene: AGAP011528   Transcript: AGAP011528-RA
Sequence length 234
Comment pep:novel chromosome:AgamP3:3L:26566523:26572486:-1 gene:AGAP011528 transcript:AGAP011528-RA
Sequence
MCGSDLRTIRTLASLDLETKPNYWLTVCAQDQAVVPLHSCVQVYIEVQNENDNVPLTEDA
VYYPSVPESSPPNVKVLQLAAEDRDIDPLQQISYRIISGNPEGNFAINSTSGLITTTARK
LDRENQPEHILEVLVMDNGEPQLSSTTRVVVQVEDVNDHAPEFDQKMYKVQIPANAKIDQ
PLFQSQIKILIHYQYCCEWSGRKCFPYPCSVEGLQTVEFEGTADAHIPAPNAPA
Download sequence
Identical sequences A0A1W5C927
AGAP011528-PA 7165.AGAP011528-PA XP_307204.4.40869 AGAP011528-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]