SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP011529-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP011529-PA
Domain Number 1 Region: 529-646
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-30
Family Cadherin 0.002
Further Details:      
 
Domain Number 2 Region: 210-315
Classification Level Classification E-value
Superfamily Cadherin-like 9.68e-29
Family Cadherin 0.00096
Further Details:      
 
Domain Number 3 Region: 428-533
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-27
Family Cadherin 0.00082
Further Details:      
 
Domain Number 4 Region: 317-426
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-22
Family Cadherin 0.0022
Further Details:      
 
Domain Number 5 Region: 2-90
Classification Level Classification E-value
Superfamily Cadherin-like 8.51e-17
Family Cadherin 0.0072
Further Details:      
 
Domain Number 6 Region: 115-216
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000143
Family Cadherin 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP011529-PA   Gene: AGAP011529   Transcript: AGAP011529-RA
Sequence length 652
Comment pep:novel chromosome:AgamP3:3L:26625291:26633350:-1 gene:AGAP011529 transcript:AGAP011529-RA
Sequence
AITEDTPLHKSILHVVAEDADLGLNGEIYYSILDETEQFAVHPTTGVITLTRPLRFAERA
LHELTVVANDRGIGSTSRNQASKARVKIKVLQVSCGHSTVITRIYWTYAFALPDILENSN
TNIFGIVRVTDKDKGVHGQIKSLDIVDGDPDGHFRIKPTDRPGEYVIEVHRLLDRETAPA
GYNLTLRAVDRGVPPKQSYLVTPVRLADINDNAPVFNREIYEVSVPETSPPNTPVIRLKV
TDRDEGKNAKVFLEIVGGNEGGEFRVNPETGMLYTAVPLDAELKAFYTLTVSAIDQGNPG
TRKQSSAKVKINVQDTNDNDPIFETANLTIYVDENEPAGTSVTKVTARDKDLGENAYISY
SIANLNDVPFDIDHFSGTVRTSKLLDYESMRREYVLRDEYLLNITVYDLGKPQKSISKIL
PLTILDENDNVPKFEKSLASFRVTENAINGTIIFRVKATDADLGQNAKITYSLVTDTKDF
RVDPETGVLTVVAPLDRERQEVYELKIRATDGGGDQNTPALYSDALVRVTVDDINDNAPE
FAVQDLTVRIREDVPRGTVVTVVSAIDLDSGTSSEIVYSFGENGDGEGSFRIDKQSGTIR
TARMLDFEERQVHSLIVKAIDRGTPSLSSETSVIVEVIDVNENRFAPQFEDY
Download sequence
Identical sequences Q7PTV6
AGAP011529-PA XP_307203.4.40869 7165.AGAP011529-PA AGAP011529-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]