SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP011770-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP011770-PA
Domain Number 1 Region: 322-575
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-48
Family YWTD domain 0.0000026
Further Details:      
 
Domain Number 2 Region: 627-888
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-42
Family YWTD domain 0.0000132
Further Details:      
 
Domain Number 3 Region: 25-244
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-39
Family YWTD domain 0.000019
Further Details:      
 
Domain Number 4 Region: 936-1154
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-28
Family YWTD domain 0.00044
Further Details:      
 
Domain Number 5 Region: 582-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000136
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 1239-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 1287-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000576
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 891-939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000359
Family EGF-type module 0.019
Further Details:      
 
Domain Number 9 Region: 1322-1361
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000034
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  AGAP011770-PA
Domain Number - Region: 1194-1235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000758
Family EGF-type module 0.0084
Further Details:      
 
Domain Number - Region: 274-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP011770-PA   Gene: AGAP011770   Transcript: AGAP011770-RA
Sequence length 1619
Comment pep:novel chromosome:AgamP3:3L:33079221:33085999:-1 gene:AGAP011770 transcript:AGAP011770-RA
Sequence
LLFTTYYDLRVLNVSVQPDTNALTYTMDVLLQDLNEASAMDFYHARGLVCWTENTLEVIQ
CGRTNGTLSVTSKTTVITDGLDKPEGLAIDWYTDKLYWTDGESNRIEVAANNARLQKVLI
WSDLDQPRAIALVPARRYMIWTDWGESPKIERASMDGDPQSRTVLVNDRIFWPNGLAVDL
EQELIYWVDGNQRFLDVMDLDGGNRRTLVRNLDYPYSLTFTANFLFWTDWKDGTLHYYDI
QRDRHKELLRKTEVPITVHAWDGRLQPEAATDASNPCRRNNGNCSHLCLLSTIAPAGYSC
ACPTGIKLLTATQCADGPQDMLFVVQRSQINRISLDSPDYSIVPLPAGKLRYAIAIDYDP
VENYVYWSDKEESAIKRARADGTGGPAEEIVTAEIQAPDGLAIDWLARNLYWTDTGTDRI
QVCRLDGSFRRVLIYDNLVEPRAIALAPTLGWMFWSDWGAKEPKIERASLDGTERVLIVS
QNLIWPNGIALDVGARKIYWCDAKADTIEVANMDGSGRNTILSDNLPHVFGLSLLGDYLY
WTDWQRRSIDRAHKLTGAERATIGENIAELMGLKVTRLHEVQGTNPCAVANGGCSQLCLN
RPRDYVCRCQLDYELGRDNRTCLVPAAFLLFSNHGSIGRLSIDSHNHADYAPFRNVVDAH
YLDVDVADRRIYWVSQKQKYISRAYINGSDVQRIVETGLMQPEGIAVDWLAHNVYWTDAD
ARRIEVARLDGSSRRILIWKGIEEPKNLILEPRKGLMYWTEWPSDSIRRAAMDGGDLLTI
ISGANHAIGLTLDPDTRRLYWARQSSPTGIESADWDGKRRTRLVMADAADSNRFVPVALT
IYQDWVYWADWTTDEIGRANKTTGDNRTIVHTNLKYTYALLAFHAGRQSGSNQCRTNNGG
CTHLCLAQGQRKMTCACPTHYTLNANRVSCSPPRNYIIFSQRNSFGRFVPNTADSPDIPL
PVTGKNIRAVEYDVLTRHIYWIDGRGPIIRRAFDNGTNAKVSINPTSSPFDMAIDPIGRL
LFWSCSHTNTINITTLDGNIASIGNVDIGRTEKPRSLALHPMKRLLFWTDVGSAQSITRA
KLDGSQRVELITKLEGIQALALDPQLNRLFYAHGKRIDTMDINGQDVRTLVAEHISMVSS
IAALDGFIYWLDERPVMERISVQGDNRRVEIHKNPHMTDIVAVWTPDDRALRNHTCNTAR
AECSHICIGSPDDAPADHVCACPQGLMLLKDRRSCGEQPICGPDHFTCAAPSELADRDGN
KECIPSSWRCDGQKDCPDRSDEMDCPTCRGDQFKCQSGECIDKHLVCDGTTQCLDGYDEA
VCCKNPEDFQCPTSKVCISFHNVCDGDEHCAKGEDEAPEICSEYGNRRMAPSSSKITLLI
VVVTAVAVVFLVVYLLQTFRTRFGTGGSGLEPKECDQAAAPLSPGGLNKNIRVSKLASVA
DAVRMSTLNSRTSGGSYDRNHITGASSSTTNGSSLIGYPLNPPPSPATTAGSTGRYCNSS
YHPYKHYKIINQPPPPTPCSTDACDESDSNYTSKSNRSQRGGGGGGHGSGTTGGGTSSSR
CYDPEPYPPPPTPRSHYHSDIGGMLPESCPPSPSSRSSTYFSPLPPPPSPVPSPSRGFS
Download sequence
Identical sequences Q7PV65
AGAP011770-PA|hypothetical 7165.AGAP011770-PA XP_320740.4.40869 AGAP011770-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]