SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP012372-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP012372-PA
Domain Number 1 Region: 1268-1534
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-47
Family YWTD domain 0.0000034
Further Details:      
 
Domain Number 2 Region: 3056-3319
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-44
Family YWTD domain 0.00000511
Further Details:      
 
Domain Number 3 Region: 577-828
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-37
Family YWTD domain 0.0000441
Further Details:      
 
Domain Number 4 Region: 2217-2484
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-33
Family YWTD domain 0.0000306
Further Details:      
 
Domain Number 5 Region: 1929-2135
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-31
Family YWTD domain 0.00013
Further Details:      
 
Domain Number 6 Region: 1584-1848
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-30
Family YWTD domain 0.00047
Further Details:      
 
Domain Number 7 Region: 261-506
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-25
Family YWTD domain 0.00038
Further Details:      
 
Domain Number 8 Region: 3952-4122
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-21
Family YWTD domain 0.00026
Further Details:      
 
Domain Number 9 Region: 2963-3044,3319-3373
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.59e-20
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 10 Region: 3574-3611
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 11 Region: 3400-3441
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 12 Region: 2573-2616
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 13 Region: 3-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 14 Region: 3690-3726
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000119
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 15 Region: 2537-2574
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000012
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 16 Region: 3491-3527
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 17 Region: 3530-3566
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 18 Region: 2742-2777
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 19 Region: 2825-2859
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 20 Region: 2924-2962
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 21 Region: 3609-3649
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 3365-3401
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 23 Region: 2696-2739
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000484
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 24 Region: 3730-3767
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000576
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 25 Region: 1540-1594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000914
Family EGF-type module 0.017
Further Details:      
 
Domain Number 26 Region: 3768-3805
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000123
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 27 Region: 2619-2652
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 28 Region: 2654-2694
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 29 Region: 3652-3690
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000563
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 177-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000664
Family EGF-type module 0.011
Further Details:      
 
Domain Number 31 Region: 2882-2919
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000995
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 32 Region: 2783-2820
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 33 Region: 1009-1045
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 34 Region: 885-920
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 35 Region: 963-1007
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000034
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 36 Region: 930-967
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000432
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 37 Region: 46-215
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000108
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 38 Region: 1143-1177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000128
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 39 Region: 4454-4495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000264
Family EGF-type module 0.024
Further Details:      
 
Domain Number 40 Region: 4323-4359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000487
Family EGF-type module 0.014
Further Details:      
 
Domain Number 41 Region: 3445-3487
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000877
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  AGAP012372-PA
Domain Number - Region: 4251-4289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000128
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 1189-1228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000248
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 3813-3851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00027
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 4286-4324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000295
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 1863-1908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 1228-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000483
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 4395-4431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000922
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 2173-2220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00117
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1048-1083
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00144
Family LDL receptor-like module 0.0042
Further Details:      
 
Domain Number - Region: 4361-4394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00545
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 511-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00583
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 2495-2553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0318
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP012372-PA   Gene: AGAP012372   Transcript: AGAP012372-RA
Sequence length 4718
Comment pep:novel chromosome:AgamP3:3L:41151046:41166134:-1 gene:AGAP012372 transcript:AGAP012372-RA
Sequence
FPVTCSQSQFTCVMDGKCIPALWRCDTSADCSDGSDEVGCDKAHACNEGMFHCTVSNRCI
PHDWTCDGDVDCGLVEKYDMVDVSDEDPQLCRAHTKCLPTQALCSDGKCLEIDRFCDGAW
DCSNDELNCSSNDTATASAPTSACDALKCSYDCRLTSEGARCFCAKDSQPNGSVCEDFDE
CQIEGLCDQMCKNQPGAYQCSCTTGYVRQGNTCTAVNLPKDEPTSLFFTTFNKVKKVSIS
NRTSVLAGNFPTNETVEEEYLKQPNPRIRAMEMVHRNRTFCLARIDGKSLLECYSVDNTS
HSWVMPRPDLFPNLEDIVDIRLDWVSGNWYYLDQQREIIFVCSPQMVHCAIIVEALSEVL
RPRRMALDPTKGFLFFSKWGSGDVSIERSLLDGTNRTSIVLNKIITPLDIALDLVMQHVY
WVDTHLDTVQRVNYDGSGRWFPKRSTQFLFNFQMLYALDVFERTIYLASWQNGSIVALNG
TTGEARVIVPNAPHAVHLHVFHRQKQPEVAHPCRIQNGGCDQLCIPVWKKIGVAIAQCMC
SPGYRLKTKSQCVLIKRPTFLLYAKSNPAMIRGFAVGIKSQEAIVPITDLGPHITFDYHV
EDQLIFFSHGVIDKPSFRIEAQKLDGTQRELLLESPGSCDGISYDWLGNNIFWTDSDRNH
ISVIKLGPKRMRYTVLRQLYAPKSIVVDPKQGWMYWSSWSVPSGRIDRAWMNGTQPELLV
SSKERPIEWPTGLSIDMIQKRLYWCDARLSFIESINLDGSNRVLLFDGRSQNQFPVALAV
HRQLLYFADNVKGHIEKLNLSDPHLLETITIEKPQVLGLKIFDNLTQYGGNGRNACEIDC
PGICLNTPVAVASCKCEDGQVLSLSSEGKPVACVPFDLQHSLASCNNSTHFLCRNKIDCI
EIKYTCDGDRDCEDGSDEETTPDGPCDPNCDLERNFKCDEQRCISRSHVCDGSVDCIDES
DEDYINCPNKTCSEHFFQCEVSHRCIPNTWVCDRHLDCGPNDSSDEPEHCHKCPEFECKN
SACVPFEFLCDGVDNCGDKSDESQCDVDCGVNEFFCSPHGCIDRSLMCDPKLNCLNAFHE
CDKLHKAGSNGTTQSSVPVRSEPELKDLCRQDLRIVCGLDKQCEENYNRVCQRMEFAPFN
ETMVCHHPDRLCRVTNQCIKVTQLCNGRTDCPDGTDEGFRCAEKLCDAPNDCSHACHNAP
EGLICSCPAHLFLQPNGRDCGHDHACDNWGTCSQICTKAGTHYRCGCVEGYTLMYDKFTC
RSNNGDSPYVIFSNRQEILGVDLNTLGVRSFYTSLRNTIALDFLYRNESVQIFWSDVMDD
KIYRGTLRNDTLSNVEAVVQSGLSTAEGLAVDWIGMNIYWIDSNLDQIEVAKTNGSFRRT
LVAGDMVNPRAIALDPMEGVLFWTDWEEGSPRLERCTMAGENRTVIKYVGSDGGWPNGIA
LDYIPRRVYWIDARSDSIHTITYDGQDHHLVIKDQGVLAHPFSITVFDNYVYWTDWRTYS
VIRANKWNGTDVNVIQKTQSQPFGIQILHSSRQPNTQPNPCADNNGGCSHLCLLSVGSRH
ECACPHVMRLHEDRRQCVPNEEILLFVVLTEIRGVDLQQPAHYTIPTISHQTQVVQPAVL
DYDISAARLYWNDIQLNEIKSSGLATGPIETILDTDISNSLGFAVDWISKLLYFSTGNET
HSRIMVSNLNGEFVTEIADGLSVVNSLVVYPTRGMMYFATMSEVPKLYELYASRMDGSER
QLISNSTFHPIDSLALDFETNRLYYISSNAGEINYYDIGSGKIIQVLAPHEDNHPISTIT
IYRDSIYYDDNHDGRIMRCNKNLCQNPVSVRNNTSGLNAIRMYHPGAQSGTNSCQKRNDK
SAGTGCEHLCIPVSAQSHVCRCAIGYRSDPRNPWRCIGLDDILVYSVGHQLKGIALSSSD
ESTGSLRNRESLGPLQQISLATSIDFDVAHDYVYIADTDRGSITRIKRDGSAREVIISNF
EQVVDGSTLDWLGGIAIDWVAENIYWTDQKRNLIEVARLNGTLRYVVASDVESPQLLAID
PIQGYLFYVTRGTIGRMGLDGSGNFILVNRSSAISDLALDLDNQVVYWCETSTDTIWKVD
YDGNLKRLLLNGTSHNPKSLDLFGDSIYWADSRGNIYEAGLSNIFNYRSVVEALEVSSLK
DIKVFSSRKQSKTNACGVSNGGCQELCLFNGTHPICACSHGKISSADLKTCEPYENFLIF
SRQSAIESIHMTDANNINGPIPEIKNSSYLKNTIALSYDYEQQLIFYSDIDHSTINCVFF
NGTNHRRIVTKQLTVEGLAFNVLTRVLFWTSNNEAAIRSLDLNKASLTDPAANAELVQDV
IKLRATDKPRGIAVEPCLAMVYWTNWNQHAASIQRAYPSGYGLESIITSDIQMPNALTLD
YQARKLYWADALLDKVERTDYDGKHRVVLAHSTPKHPFALAVFGDLLFWTDLTVHAVIRA
NKYSGSDIVLLRRDIAQPMGIVAVQQIDKECSADPCQVMNGFCEDVCLIDAAGKVECHCT
QGVLAADGQRCIPKSVSNCSSSEFSCTNGNCIPFHLTCDGVKNCLDGSDELVTFCAHRPC
PDGFFRCNNARCIPKNQQCNHIQNCGDGSDEVGCSCNNATHFRCTDGQCIVKSMRCDYEP
DCKDVSDEIGCPVMRNCTEGFVNCANTTGCYMPTWRCDGENDCWDNSDEQDCPTAIPTCP
EDKFLCANGRCIPQSWRCDDEDDCTDATGGGLSSDELACVKHCKPNQFKCTNTSECISNS
WQCDGHPDCADGSDEGDHCSRRDCPETEFQCPTTNRCIPQKWVCDGEVDCGATQDDEMGC
DEMMVNECDKTSFTCKNGECISLLHVCDGEQDCVDGSDEPLYCKEGDDGYDEEEGAGVDD
HLCVEPDHFRCNNGRCIERNLTCNVNDDCADGSDEDIRLCRNTTLICAGPDLFRCESGAC
ITSNMLCDGANDCGDWSDEKSCQVNECEMIPDLCAHECEDRPVGYECVCRKGFRVNVNDK
HLCVDVDECTEQQPRPCTQTCVNTHGSYHCTCLDGFVLRDNDTCRAEGRHILPPKLIFSN
RYYLREVDLSGGMTILAHNLTNAITLDFDWKDECYYWSDVTRTVTTVKRMCESGEENRPV
EVIHRTNLKNPEGLAVDWVGRNLYWCDKGLDTIEVSKLDGRYRRVLINKELQKPRAIALD
PYRRYMYWTDWGDQPHIGRAGMDGSNQTILIKEQLGWPNALTISFETNQLFWGDAREDYI
AVSDLDGQNVRILLSRARQPTLNLHHVFAIAVWEDRIYWSDLDSKSIEYCHKFRGDGCGT
LINTIHRPMDIRVFHYYRQLQPEVNPCDTAGCQTLCVLSPDPPGYRCLCPDNFILTADGK
SCAANCSAAHFQCRTTFKCIPFYWRCDKQDDCGDGSDEPPNCPTFTCEAGQFQCLNKRCI
NPSQICDGVDQCGDLSDERDCDRFECFSSHFKCGPSAAKNTSGFCIEGARRCDEEVNCPN
GEDEQNCEPKNCTATQFRCANGGRCIDRTWVCDNVPDCHDGSDEQVCGPATTCPEHEFRC
SEGRCIPQSWLCDDEKDCANGEDETENCQKPEAITCEPTSFRCNNSKCIPGRWRCDFEND
CGDNSDELNCELRNCSESEFRCRDGHCIRGIRRCDNEFNCADHSDEENCNVTCSAEQFKC
KSHPACISNKFKCDGDNDCIDESDEEDCECQEGEYRCNNGKCILSSWVCDGIDDCLDNSD
EMGEYCKEHGCNKRAFRCANRNCIRKSLMCDNKDDCGDNSDEKSALCHKCPPNSFRCNSD
SKCIDIALRCDQTPHCLDESDEIGCIKTGCGFGACSQLCIEKKGHYTCRCAEGYVKGGPG
RNATCVAVDEQGILLVASESDFRSLYADTPVMGYLQTSSLKIDRFDFAITRHNITLFWID
SYDTSINKILMDTTVKDGGDYSRSPPVDKRKIVRRGLGPAPAPPSYDRIKTLDGKHSSVV
LKDDEIHPIAIACDWLTERLYVINKKRSNIFVMSFNGTNHTTLTATGKHPIDLVVDPVSG
MMVWSIMETIISSGMDGRGKQKLVHTNVEWASGLAIDTTTKRLYWADYRKSTIETCLLLT
GGDRHVIAELHDYSKPKLLDVFEDSVYVILYNQNILKLNKYGRDNGTYMNEEARGAGGLA
GYRSSDVHFIHPLKHDRSVPNPCIISPCHNSTVCLLSTVSRLKRACVCPDARPRIVFDER
GEVKECLDLPAQAPECKLHCNNGTCFIDTDGQQKCKCSASFDGKYCDHYICSGYCKNKGF
CELVNGEPQCTCLPQWTGKRCDISTNKCQRYCHNGGNCTIVQRDGGSLSCSCPVGYTGEQ
CEHCSNLRCENGGVCRKTTTDRSQCLCAEGYVGRNCEKNVCTEFCENGGECTIERGAAKC
SCPENTYGERCQLRQCADLCRNGGDCVPGERPYCKCRQGYEGPYCEHDLCELPEGTRPSY
CSTIRPTTEPSAHPPSSSCGSYSCNNGGHCLEVRGKPICNCTMQYAGEHCENYVMYLNPC
NRYCMNNGICQLDLGFFSSNVTYIPSCVCIGEWTGHKCDLPPRCVGECGTCIEGSSINEC
ICDDNPVPYPCQQVVSLSELERMESNDSSYTLSVLAIALFVILIVAAGFGGTIYGLRRRR
TGQPFLHARLTDNVEITNPMYLGDADEGPAFVHEDDKVHFGNPVYEQMYAGSVNVHSDSS
TIAGNSAHPLLTTSSTAPEEKKGLLQHPQEDTIAADLL
Download sequence
Identical sequences Q7PV66
AGAP012372-PA|hypothetical 7165.AGAP012372-PA AGAP012372-PA XP_320185.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]