SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP012913-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP012913-PA
Domain Number 1 Region: 4-280
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.37e-73
Family Ankyrin repeat 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP012913-PA   Gene: AGAP012913   Transcript: AGAP012913-RA
Sequence length 282
Comment pep:novel chromosome:AgamP3:UNKN:38506258:38507195:-1 gene:AGAP012913 transcript:AGAP012913-RA
Sequence
QNNTTVLMVASGRGATHFVKELLARGADVQAQDLDSWTALHFAAKAGHVGIVELLLDNGA
ELEHRDMGGWTALMWGSYKGHTSVVALLLQRGADVQAHGNYHLNPLLWASGRGHTEIVRL
LVNTGGAKVNVGDKYGTTPLVWACRKGSAEIVDVLLKAGANVDTAGMYSWTPLLVAVSGG
FQECVSLLLERKPNVNALDKDGMTALSIACREGLTEIASALIAAGAYLNVQDRAGDTPLI
NAVKGGHRSVVEILMKRHVDVDIQGKDKKTALYTAVEKGHTA
Download sequence
Identical sequences Q7QMF9
AGAP012913-PA|hypothetical AGAP012913-PA XP_306335.4.40869 7165.AGAP012913-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]