SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP000123-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP000123-PA
Domain Number 1 Region: 102-278
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-26
Family C-type lectin domain 0.00093
Further Details:      
 
Domain Number 2 Region: 2-136
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.63e-25
Family Fucose binding lectin 0.0018
Further Details:      
 
Domain Number 3 Region: 279-348
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 4 Region: 337-405
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000931
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 394-455
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000139
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP000123-PA   Gene: AGAP000123   Transcript: AGAP000123-RA
Sequence length 677
Comment pep:known chromosome:AgamP3:X:2005428:2014162:1 gene:AGAP000123 transcript:AGAP000123-RA
Sequence
MQISTEASGIPQKAIDGSTSAFFSPDTCSLTKPERVPWWYVNLLEPYMVQLVRLDFGKSC
CGKGKPATIVVRVGNNRPDLGTNPICNRFTGSLEEGQPLFLPCNPPMPGAFVSVHLETNA
PSQLSICEAFVYTDQALPIERCPAFRDQPPGASASYNGKCYIFYSRQPATLRDALAFCRA
RGGTLINESNPALQGFISWELWRRHRSDTSSQYWMGAVRDAQDRNTWKWIGGEEVSVSFW
NLPGGDEDCARYDGSKGWLWSDTNCNTQLNFICQHQPKACGRPEQPPNSTMIAPKGFDVG
AVVEYSCDEGHLLVGPKQRTCLETGFYNEFPPVCKYIECGLPASIPHGYYDLVNGTVGYL
STVMYRCAEGYEMVGRAVLICDIDERWNGPPPRCELIECDPLPTLFPNGVIVSTNQTVYG
TRAEVHCNRGFVPDSEPEIVCTASGQWSHPLPKCVPDQSAGPATVRPSAASTTPASSRAP
PVLIVSPTTPASIGGIPSRARQPTGGRRPGSTVRYPTQAPPASSTVSAAESTTASIVINM
AGPTTAQPSRTTSTTDPPAVVSVTPQVQTHRPQVTGTTGRRPSTTTTTRGRHPAHEQDIL
LSHHPQDNEIPGSVNIRQDQSPKVNVPFAVNNVDDLESKNAKLNLGAIVALGAFGGFVFL
AAVITTIVIVVRRTTRA
Download sequence
Identical sequences 7165.AGAP000123-PA AGAP000123-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]