SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP000331-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP000331-PA
Domain Number 1 Region: 2288-2549
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-45
Family YWTD domain 0.0000119
Further Details:      
 
Domain Number 2 Region: 1338-1597
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-44
Family YWTD domain 0.00000549
Further Details:      
 
Domain Number 3 Region: 3110-3375
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-43
Family YWTD domain 0.00000512
Further Details:      
 
Domain Number 4 Region: 3984-4254
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-42
Family YWTD domain 0.0000297
Further Details:      
 
Domain Number 5 Region: 614-849
Classification Level Classification E-value
Superfamily YWTD domain 1.22e-41
Family YWTD domain 0.0000238
Further Details:      
 
Domain Number 6 Region: 1987-2229
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-33
Family YWTD domain 0.0000394
Further Details:      
 
Domain Number 7 Region: 279-507
Classification Level Classification E-value
Superfamily YWTD domain 1.18e-31
Family YWTD domain 0.0000491
Further Details:      
 
Domain Number 8 Region: 1650-1919
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-28
Family YWTD domain 0.00018
Further Details:      
 
Domain Number 9 Region: 1251-1332,1625-1638,1916-1965
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.49e-19
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 10 Region: 168-268,528-583
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 11 Region: 2631-2674
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000785
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 12 Region: 959-1000
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 13 Region: 2758-2800
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000759
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 14 Region: 105-146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000117
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 15 Region: 3473-3513
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 16 Region: 3684-3721
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 3725-3762
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000733
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 18 Region: 1003-1038
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 19 Region: 3022-3102,3369-3444
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000022
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 20 Region: 2897-2933
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 2596-2633
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 22 Region: 2941-2977
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 23 Region: 1039-1081
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 3558-3596
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 25 Region: 3929-3970
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 26 Region: 3856-3892
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000118
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 27 Region: 2806-2842
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000127
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 28 Region: 2982-3015
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 29 Region: 3769-3813
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 30 Region: 66-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 31 Region: 925-959
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 32 Region: 1083-1121
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 33 Region: 3811-3847
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 34 Region: 1132-1164
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 35 Region: 2721-2760
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 36 Region: 3516-3554
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000055
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 37 Region: 3641-3680
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000694
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 38 Region: 3900-3944
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000082
Family EGF-type module 0.013
Further Details:      
 
Domain Number 39 Region: 1167-1201
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000838
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 40 Region: 2674-2714
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000995
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 41 Region: 3435-3470
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000445
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 42 Region: 3594-3638
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000107
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 43 Region: 1211-1246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000353
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 44 Region: 2853-2890
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000916
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 45 Region: 2241-2283,2550-2618
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000706
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  AGAP000331-PA
Domain Number - Region: 4313-4351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 18-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number - Region: 4260-4290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0123
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP000331-PA   Gene: AGAP000331   Transcript: AGAP000331-RA
Sequence length 4556
Comment pep:novel chromosome:AgamP3:X:5789782:5809611:-1 gene:AGAP000331 transcript:AGAP000331-RA
Sequence
INPYSTSLVSPPPLPAYRKCQTDDIRCGAPSLGVSLNGRVAEICVPKEKRCDGYLDCRTG
KDEEGCPGTACRLDQFRCANGVRCIDTALKCNHKNDCGDNSDEVGCNFPPCHGGQFRCAN
ALCIPATFHCDGYHDCSDESDEANCTAIACPDNKFLCPRGGPNGQAKCIVKSKLCDGKRD
CDDGTDEETACSTTSCPALGCEHKCGPSLTGGVCYCPAGRTLSPDNRTCADLDECTVWGH
CDQLCTNTDGSFSCACATGYTLMEKTRCVAPTASSLELFFAYDRAILRMSAHGQDSRIIA
NATGASGLSYHYAKNLLYWSDIKTRKVQSQVLVDGGFGGHDFTLPGTWAPVAIAIDWVGD
KLYVADLVGQKVDVFELDGRWHAVVLGSNLTSPADLALDPTAGLMFVADGSHVLRAHMDG
THAKSIVSEAAYKASGVAVDVIARRVFWCDSLLDYIESVSYEGERRVMILRGQQVPSPSR
LALFENRVFWSDATKQGIMSVDRFEGSSSIQSIFKAKDIREPRALIAVHPLTQPKVSNPC
GSNNGGCSQMCVVTAVQGAPSGLGYRCACHTGWQLSKDLMNCHLVRQFLMYSQQRFIKGK
VLDPVIEGFSDAILPVVSRRARFVGLDFDAVDEHIYYSDVLQDVIYRVHRNGTGREIVLA
SQNEGVEGLAVDWVSKNLYYIDSRKGTLNVLSTRNTSYRRTLLKNLKRPRAIVVHPNRGY
IYFSEWDRPANISRANADGSGLIVFRNLTLGWPNGLSIDFREDRVYWCDALLDHVQHANL
DGTDVRTVNSRLIRHPFSIVIHEEWMYITDWRLDAIVRLNKLNGEQEEIMVREPQTNRLY
GVKVYSHGVQSIDASQPCGVNNGGCEKLCFALPRNDTEDAAAASAGGPTSPRLVVKCGCP
YGERLGDDGRSCLSDPNAEPPVQACPNTWDFTCNNQRCIPKSWICDGDDDCLDNSDEEQN
CTKPTCGTNEFQCKSGRCIPLNFRCDQENDCGDHSDEFECGNVTCAASQFACENGRCIPN
IWKCDSENDCGDGSDEGPFCAEKTCAYFQFTCPRTGHCIPQSWVCDGDDDCFDKQDEKDC
PPITCLANQFKCADLRQCVEEPYKCDGIPDCNDGSDELGCPTMEPNQCNLEKHFRCRSSG
VCIPIAWHCDGSNDCDDHSDEEDCSKITCPNGFYKCANAKCVFKAYICDGKDDCGDGSDE
SVEHACVTPPQRCAHGQWACPGVTERCVNLTSVCDDVPDCPNGADEGLGCDLAQCQHQTG
LCSNGCQKTPLGALCICPPGEELAPDNFTCKDLNECDPPGLCSQRCTNTKGSYFCSCVDG
YVLEPNKHTCKAVNHPAAFLIISNRHSILVADLKEQGLERVPIIVENVVATASNMHTGTI
FWSDMKLKKISRLDRGMEPQEIISTGLDLVEGLAYDWIGQNLYWLDSKLNTIEVAHENGS
NRLVLVRENITQPRGMCLDPSPTAKWLFWTDWGENPRIERIGMDGTMRETIVSTKIYWPN
GLTLDVATQRVYFADSKLDFIDFCYYNGTGRQQVLAASHYLLHAHSLSLFEDTLYWTDRQ
LNRVLSAHKYRGTNQTVVSHLISQPLSVHVHHPSLQPMYESPCKRAACQHVCLLSPSEPA
GYACKCRPGYRLLPEGRCTEEENAFIMLLKGNQIVDVPFNGGDARSSGLMPVVGIEGGIS
LDYDRKGEMVYWVQGRDESDDENCTIYATPYGGGNRTEFLGPDTGLVGAAYTIAFDWIGR
NLYVGNRLASNIEAISVDGKVRYRTVVLANDGNRTSVAKPKQLALDPADGRLFWIDEGGF
GVLTKVASAGMDGSDPRVLDDTVQFPESITVDAEKRRVYYSTRLPPAVLSIEYDGTGQRT
ILSEENAISKPRALAVLESRLYFLDPTYEKLARVDLPNGDNAKLILDNEPDLRQMVIYRK
RSSLQHPCTQNNGGCEHLCLPHAGASRVCACGVGYKKENEVACTPYKTFAVVSQLDVTRG
FSLRDSTEAMVPIAGPGHHILHVDVLYRESWIYWVEYNRGHWNGIFRVRPNGTELQHIVK
DGIGSNGIRGIAIDWVAGNLYFTNVFPHENYVEVAWLDGTHRKVLVKTTNDAPRELAVNP
IKRLLYWIDYGQYPRIGKCFLDGSNWTPVVTSGISNPRDLTVDMLTHDVYWVDSKLDMIQ
KVSYSGGHRQVIRRNLANPMALAVFLTDVYWVDRNLASVFRASKFPGNSTRPERLRTNLP
KLRDITIYDINSQPMDDANPCLRLGNGGCDQLCFALPPDYSQKPSFRCDCAVGRLGADGR
HCELTDEYIIFATRTEIRAIDLDPASTNVPFAPVANLTNVVGLDFDYADNKLFFTQIRPW
SKIAWLRGDKPDAAAITPVMTRGINPEGIAYDWTQRKIYWTDSSNNSIYAMNTDGTELVM
IARVERPRAIVLDPCNGTLYFTDWGRFGTSGKIFRTTMAGSLKRAIIDRDLSQPSGLAID
YDDRMLYWTDAVREKIERSQLDGRNREVLISATIYPFAITVFRNYIYWTDLQLRGVYRAE
KHTGAGVHEMVKRLEDSPRDIHIYSATRQQCQANPCLQNNGGCAQSCHPGANGKPECKCD
DTTKPVNEGRMCAPKNHTCDASKFYCQNGKCISRMWSCDGDDDCGDGSDEDVNYCAFHSC
AANEFRCANGRCIFKSWKCDHENDCKDGSDEEGCSYPPCVDGEFTCANGRCIPQAQVCNG
VNDCKDNGTSDETHERCPTNTTCPPNHLKCDRTNICVEPYWLCDGDNDCGDNSDENPLHC
AQRTCPQNSFRCPNHRCIPATWYCDGDDDCGDGADEPPEYCKSEGRTCFGDLFTCDNGNC
IPRIYICDGDNDCLDNSDEDNRHQCNDRKCDEDTEFTCHENKAWARAQCIPKKWICDGDP
DCVDGADENTTLQHCPSPQPCGEDMFTCANGRCINQGWVCDHDNDCGDGSDEGKNCNSQY
KTCTPQEFTCQNFKCIRNQYRCDGEDDCGDHSDEVGCKKDNATCAEGKFTCNNGQCIDYH
LVCNKVPDCTDESDEPLHCNVDECAKVEIHRCGHKCVDTLTSYYCDCNQGYKLLEDGKAC
ADIDECIETPGVCSQHCSNTPGGYYCKCDERYYERQNDEHTCKRKDDTKPWLIFSNKYYV
RNMSTDGHQYNLIHQDLMNVVAIDFDMQQHEMYFCDVTAKTIFKSSFGSLVEDGVRIEKT
PVIKHDSHGLEGIAIDWVGRKLYWLDRHSKNLDVAELDGTRRKTLRSGVVDPRAIVVHPG
IGYLYFTSWHLQAYIAKMGMDGSNFTRILTWEDDIAWPNALTIDYFTDRIYWADAHLDYI
AFADLEGRHRHVVLSGARVPHVFALSIFDDSLYWTDWNLKAILRANKFTGANYTVVRNTT
HRPYDVHISHPLRQIPFPNPCGTTNGGCSHLCLLAPPLESTYLNVEGYLEEGAPSYRCAC
PNQFYLARDQKTCIANCTSGQHRCGGDDEKCIPWFWKCDGEPDCKDRSDEPASCPARHCR
AGTFQCGNGNCTPSTTICDGTDDCGDGTDEQNCDLPCPVSDFKCKSSGRCILDSWKCDGD
ADCKDGSDEDPEICHKRTCDPETEFSCKNGRCIPKLWMCDFDNDCGDDSDEPAYMCRQRN
CTTGWSRCPGQSNYRCIPKWLFCDGKDDCRDKSDELPENCPQCNQETDFKCNNNRCIPRQ
WMCDFADDCGDGSDESETQCKGKYRECSESEFRCDNGKCISSRWRCDHEDDCGDNSDEYG
CEGFQCKNGTFQCKSGHCIAAYFRCDGDRDCRDMSDEIGCPPRFPGGRYCPESRFQCANN
LCVLPSDLCDGTDDCGDNSDEAASVCTNFNCDTLRRFQCANHRCVARYQICDGVDNCGDG
SDENNMTLCAARQKPCDLYTQYQCANKKCIDRAQVCDYADDCGDGSDELGCHRTASCSAL
NKGGCEHHCVNLTDGYICACYAGFIIDASNKKRCTDIDECATGTHGCSHLCTNLNGTYEC
GCREGFRLSDRVSGVCKALKGEPLLVLSGGPEIRAYEPAQNRQFDVIAGEKRIEALDYNP
ESQMIFWTDSYDKTIKRSYMVNAMNGDAKVGYAQDLNMKGGTKPTALAVDWVADNLYWAE
TDRTGSKPRGRIMVAKTDGRYRRALVQAGLEVPTAIAVDPQLGRMFWADAGSAPKIEVSW
MDGSKRRPIITEAIRHPAGLTVDYSQDHAVYWVDTKLNTIEVMKPDGTMRRTVLKGDLLK
HPVSLDVFESSLYWVTRDTGELLRQDKFGRGVQVTVQRNLANPSSIKVYHELRYNTTLNN
PCYRNPCSHLCLLVPGGRRCSCPDNTVPTSHRSTAEVVCDAPAERPRPAPRVCPCQNGGL
CKEADAGPGAPSSELVCVCLPEFSGTHCEVYSEKILGAAGSSTTAIFVPLLILMLIIIAI
GLFVIVKKRTFGKPSLSSSQSVSFRPGTNVEFNSSEFPSAQRLPGVPGGAATGTTAGTAV
TPLDGYSLDTLNNKNTDFSNPMYDAVQAGSDPMPTSNMPSDIYEVPSDVGKLNGRKEGSS
LSTGPFTEPVSAILAPSSITHKTSPQLNLRPKELNPSMHDTGKDTQLLVEEDKSEC
Download sequence
Identical sequences AGAP000331-PA 7165.AGAP000331-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]