SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP000359-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP000359-PA
Domain Number 1 Region: 99-395
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.42e-34
Family NodB-like polysaccharide deacetylase 0.032
Further Details:      
 
Domain Number 2 Region: 27-87
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 6.54e-16
Family Tachycitin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP000359-PA   Gene: AGAP000359   Transcript: AGAP000359-RA
Sequence length 492
Comment pep:novel chromosome:AgamP3:X:6358177:6368050:-1 gene:AGAP000359 transcript:AGAP000359-RA
Sequence
MFLPYIVCFLRLFPTAQQNKEEKEFKCPVEQGNGNFADPVTCRRFYQCVDGFPYLNRCPS
GLYFDDIQKYCTFKAEAKCGPLAATPAATTESPIDLAKKCNPAECELPYCYCNKDGTLIP
KGLDPEETPQIILLTFDGAVNLNNYEHYRKVFNGKRKNPNGCDIKGTFFISHEYSNYQQI
QTLANDGHEIAVETISLQMGLQDKGYEEWVGEMIGMRSILKHFSNVSANEINGMRAPFLK
PGRNTQYKVIEDFGFIYDSSVSVPPSPIPVWPYTLDYKIPHECKSGTCPTKSFPGIWEVP
LNAHFVESYEGGHCPYMDQCVLHNHDAEDVFAWLQEDFERYYYQNKAPYMMPFHTNWFQI
KELERGLHKFLDWTQTLPDVWFVTITQALTWITDPKTNKQLGGYEPWNCKSKSTQTPKPC
NISNKCALAFKEPTSNISDTRYMETCFDCPAVYPWLGDSHGSGIPGRDNYIDQSEGGGAS
AGRDQGDEEEQK
Download sequence
Identical sequences Q7PS06
AGAP000359-PA|hypothetical AGAP000359-PA XP_310753.4.40869 7165.AGAP000359-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]