SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP000638-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP000638-PA
Domain Number 1 Region: 31-147
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 2.88e-26
Family Insect pheromone/odorant-binding proteins 0.01
Further Details:      
 
Domain Number 2 Region: 152-260
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 2.09e-16
Family Insect pheromone/odorant-binding proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP000638-PA   Gene: AGAP000638   Transcript: AGAP000638-RA
Sequence length 320
Comment pep:known chromosome:AgamP3:X:11413679:11414777:1 gene:AGAP000638 transcript:AGAP000638-RA
Sequence
MISIELKYITLACVLAATVTAGSHCHNDYYQLKSVSQAQEECARYQGIPCARLAVYNKYI
YPNDTQTQCMVRCMGLNLGWWNDTHGVQEPAMRSFFHPDPDDCDYERRTYHCLNSQRLNH
PSPHVDVCERAYESFRCYYEQYGNIVVTPQFVPLSDLQQVDVLLQCANMLPLTVGRSCAG
GSKPSERDVDCLARCFLLRSGLYSEQHGPHLDRLYVQCNNYANETRFRETTGTCYRRLKS
ECQDECVLAGRFLRECFYEGGISIVNSLPASEASVESAGSLGSGQGSAELGESHQEKVLQ
TWKDLYDRENLQDLWDRQEL
Download sequence
Identical sequences Q8I8Q0
7165.AGAP000638-PA AGAP000638-PA XP_311165.1.40869 AGAP000638-PA|odorant

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]