SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP000733-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP000733-PA
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.13e-19
Family Ubiquitin-related 0.00023
Further Details:      
 
Domain Number 2 Region: 214-280
Classification Level Classification E-value
Superfamily XPC-binding domain 2.09e-17
Family XPC-binding domain 0.00062
Further Details:      
 
Domain Number 3 Region: 136-191
Classification Level Classification E-value
Superfamily UBA-like 0.000000000415
Family UBA domain 0.017
Further Details:      
 
Domain Number 4 Region: 298-344
Classification Level Classification E-value
Superfamily UBA-like 0.000000255
Family UBA domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP000733-PA   Gene: AGAP000733   Transcript: AGAP000733-RA
Sequence length 348
Comment pep:novel chromosome:AgamP3:X:13412128:13413479:1 gene:AGAP000733 transcript:AGAP000733-RA
Sequence
MKITLKTLKQQTFFVEVDVEQDTVRTLKEKLHAESGLAYPVDRQRLIYLGKIMEDDHLLS
QYKLDDKKFIVVMSKKPPADEPAPEQKDASKPSTGSAVTATASSTATPSPAPAAAAGAPS
TASDQKTAAAASPAADSSNPTNPSTDAVPEEMRINIQRLTEMGYPEQSARLALEICANIP
DRAVEYLLSEMGGGSDISGQGAGIGGAAAAQSGDANPLAFLRDNPVFEDMRRILRDDPSM
LPYLMRRMQASNPDLLNIIAEYQDEFLALINEGSNAGGQPAGQPMSRELESIAAAMVNSL
TPSDMDAIERLKALGYPEHLVIQAYIACERDEYDAAMFLVTQTLDEEE
Download sequence
Identical sequences 7165.AGAP000733-PA AGAP000733-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]