SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP000974-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP000974-PA
Domain Number 1 Region: 212-417
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.84e-48
Family Reprolysin-like 0.00015
Further Details:      
 
Domain Number 2 Region: 432-509
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.88e-21
Family Blood coagulation inhibitor (disintegrin) 0.00019
Further Details:      
 
Weak hits

Sequence:  AGAP000974-PA
Domain Number - Region: 667-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0619
Family Integrin beta EGF-like domains 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP000974-PA   Gene: AGAP000974   Transcript: AGAP000974-RA
Sequence length 819
Comment pep:novel chromosome:AgamP3:X:18738556:18759867:1 gene:AGAP000974 transcript:AGAP000974-RA
Sequence
CFEGEVERLLKEHQQNQELVDKIGSSYYQIIYPVQLRHHEKMGISTREVNQPKTGKHFHR
TSLLIKAFNHKFRLDLELNTQLLAPNIVQKHYLPSGFAQDSHREIEHCYYHGTVKDYPGA
SAAFHTCNGVSGVIHVGNETFVIHPFYGGDLSKHPHVIFEARTKSNKGCANSGNLEWRTR
SIRRGSSHHAGLVELIDRNGAGRYRRDVRETTKYIETALIIDKAMFQKRNGSTRTEVVHD
AIQVANIADLYFRTLNTRVSVVYIETWQGQNQAQIDGGKDISKAISNFNDYTSRNLYKID
KDTTQLLTGETFAGGEVGMSVPETVCTPKAVGISVDMNPYEPHLLAGTMAHMIGHNIGMG
HDDNRDECICRDWHGCIMSQSIVGLENVQPYKFSECSRLDYIDALRIGHGLCLLNKPNEV
ELRKNCGNGIVEDDEECDCGSALDCDKTDPCCDGITCKLKKESQCATGPCCDKCILKPPG
VICRDAHNECDLPEYCNGESGQCPPDVHKKNGNPCGMNSTGFSTGYCFNGVCPTQAAQCE
RIWGYSGTGADRVCYEQFNSKGSINGHCGKDANGNYIKCEPENIQCGSLQCKDGDRTPVE
DCCEHLYSRAIISIRGTEYECKSITGASTNSNTPPYGLVRDGTPCGDNLICVNQTCVSIF
PYIDQTKCPTNHNNLECSGNGDCTNNNKCFCKFGWTGPDCSIQAHITTTYPSLITSTTSE
STIIMEKKTTRYANYHGSNTVFLVGVLMSVVGGVFITFALMALCYRSKTTRLKYDPPYVK
KPMAKYVGGATAANHHSQDDVSLEGSNKMMFGNQTTQFR
Download sequence
Identical sequences 7165.AGAP000974-PA AGAP000974-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]