SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP001080-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP001080-PA
Domain Number 1 Region: 41-96
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.4e-19
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP001080-PA   Gene: AGAP001080   Transcript: AGAP001080-RA
Sequence length 97
Comment pep:novel chromosome:AgamP3:X:23370755:23371500:-1 gene:AGAP001080 transcript:AGAP001080-RA
Sequence
MQQGAQPLAAVAPSLGSALHQKPRKVKGMGKLQKSDIGSPSNFKHVTHVGWDPHSGFDLI
GAQESLKPFLEKAGVGDQHLKDRDTCAFIYDFIQTNN
Download sequence
Identical sequences 7165.AGAP001080-PA AGAP001080-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]