SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP002466-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP002466-PA
Domain Number 1 Region: 141-258
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-23
Family Voltage-gated potassium channels 0.0018
Further Details:      
 
Domain Number 2 Region: 7-34,74-144
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-20
Family Voltage-gated potassium channels 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP002466-PA   Gene: AGAP002466   Transcript: AGAP002466-RA
Sequence length 339
Comment pep:novel chromosome:AgamP3:2R:21828303:21829656:1 gene:AGAP002466 transcript:AGAP002466-RA
Sequence
MKRQNIRTLSLVVCTFTYLLIGAAVFDALESETEARRWEFLKSVKASFVAKYNITPEDYH
MIEIVITENKPHKAGPQWKFAGAFYFATVVLAMIGYGHSTPVTIGGKAFCMAYAMVGIPL
GLVMFQSIGERLNKFASVVIRRAKKYLRCQQTEATEMNLMLATGLLSSVIITTGAAVFSR
YEGWSYFDSFYYCFVTLTTIGFGDYVALQNDQALINKPGYVALSLVFILFGLAVVAASIN
LLVLRFMTMNAEDIRREEAEMQSSVDGLTTYECESTGKLLSCANLNYCSEIEEEDTSVCS
CTCLGGNSFTTHEHEFLLDQGYHPADIITSTISLKRMSI
Download sequence
Identical sequences A0A182HSZ5 A0A182JRI2 A0A182PAE7 A0A182UJZ1 A0A182UZZ3 Q7QC61
XP_312473.2.40869 AGAP002466-PA AGAP002466-PA|hypothetical 7165.AGAP002466-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]