SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP003389-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP003389-PA
Domain Number 1 Region: 176-477
Classification Level Classification E-value
Superfamily BEACH domain 2.35e-126
Family BEACH domain 0.00000000657
Further Details:      
 
Domain Number 2 Region: 532-671,702-875
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.04e-32
Family WD40-repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 78-175
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-21
Family PreBEACH PH-like domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP003389-PA   Gene: AGAP003389   Transcript: AGAP003389-RA
Sequence length 885
Comment pep:novel chromosome:AgamP3:2R:37229835:37233259:-1 gene:AGAP003389 transcript:AGAP003389-RA
Sequence
MRLKLEPDLYHDPHTAAVNMRDNTTSSTSQSRRLSSEFGSTFAPAAIGEENTDDEMLLLE
EEMRNSLEAQVPETSGREKIVITQECELITLMTRVKGRFDLTTNQLMFTEIASLKDDGQR
HDFKFPIGQLRELHLRKFNLRRSALEMFLTDQTSYFLNFTTRTRNKIFTKILSLQPPNIL
YGSGRSPAELLKSSGLTQKWANREISNFEYLMHLNTIAGRSYNDLSQYPVFPWILADYTS
EVLDLNDPRSFRDLSKPIGVVNPKNEAEVRSKFDGFEDPSGMIPKFHYGTHYSNSAGVLH
YLIRVEPFTSLHIELQSGRFDVADRQFHSIPQTWKLLMDNPNDVKELIPEFFYFPEFLKN
MNRFDLGVLQMTKEKVDDVVLPPWAKTAEDFIAIHRRALESEYVSQHLHHWIDLIFGYKQ
KGPKAVDALNVFYYCSYEGAVDLDKIANPIEREAVEGMINNFGQTPSQLLRDPHPRRLSL
DELTIRLLKLELRRPDLTLILDRVQCTACDLSTDKDPVVYLSTPKSPPRSFLQTSPDMLI
TVTKSGILGCHSWMSFDKERGFLLEIDATTLNLKNRKKLTGPFHPSITLSSKLFALSVDA
KYIYAGGIWDNSVRVFNMARGKVVASAINHFDVVTCIAMDNCGSYLVTGSKDCTCVIWSL
STSNSVSQPAGSNLQPNTAALNQNLAGNVVGSANVVHLTNNLTPKPVHTLYGHDDAVSCV
AIMTELDMVVSGSLDGTVNVHTIKNGQFIRTINPIGCTGCKIEVSFITISYQGHIAFSAL
DDTSHSVHVFSINGVSLGSKYVSGRVTGLTSSSDYLVVSDDAGDVTMSRLYGLKPIFDIP
LHVPTQTVVGTVGNTHLLAPLRDGSLGVIGIQQPIPYKKHTVLNV
Download sequence
Identical sequences Q5TUA8
AGAP003389-PA XP_558841.1.40869 7165.AGAP003389-PA AGAP003389-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]