SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP004718-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP004718-PA
Domain Number 1 Region: 20-59,125-199
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.37e-28
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 2 Region: 219-278,316-340
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.57e-18
Family Voltage-gated potassium channels 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP004718-PA   Gene: AGAP004718   Transcript: AGAP004718-RA
Sequence length 391
Comment pep:novel chromosome:AgamP3:2L:2687938:2714108:1 gene:AGAP004718 transcript:AGAP004718-RA
Sequence
MERKRSIRRRQKPPFAERAKDHCRNFTAFMFSNVGIIFLVVLYMIAGAFMFIAIEGNEAL
ERFAQIPFKRNETAMKLWQISCCEVNVFNKSVFEEKVGNEIRAYQEKIVLWARRGWQGSD
ITLESETPWSFSGAFLYSLTVITTIGYGNIVPRTEWGKIATIFYTIIGMPLFLLYLSNIG
DILAKSFKWIYAKFCLCRSTYGRARLLEIEEEITAETNTVTVPITICIMIMIGYIFFGAR
LFADWENWDILDGSYFCFISLSSIGFGDIVPGASVSEIKQNFSILQRFLKVFITTTCHFI
PQLQTKGDTKMEISFILCAVYLLLGMALIAMCFNLMQVFITTTCHFIPQLQTKGDTKMEI
SFILCAVYLLLGMALIAMCFNLMQVIVQQIA
Download sequence
Identical sequences Q7PMU9
AGAP004718-PA AGAP004718-PA|hypothetical XP_318112.4.40869 7165.AGAP004718-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]