SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP004896-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP004896-PA
Domain Number 1 Region: 164-261
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-23
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 2 Region: 76-136
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-17
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP004896-PA   Gene: AGAP004896   Transcript: AGAP004896-RA
Sequence length 345
Comment pep:novel chromosome:AgamP3:2L:5501708:5504831:-1 gene:AGAP004896 transcript:AGAP004896-RA
Sequence
IFREFERPAEVNRIQGLRKLLVQHRQEFIYSIVNNTDVQNLDRLLTLELEKYEQVVQDAA
QGGILIDANENFPVAVEKWSMLQAVFFASTVITTIGYGNIVPVTLGGRVFCMLFALIGIP
FTLTVIADWGRLFATAVSILAKNIPDLPLAKFCPDVGIKMSDKKWLYAVGAVGFLGVYLA
AGTGLLLLWEEDWDFFDGYYFCFITMTTIGFGDLVPSKPNYMLLCTLYILVGLALTSTII
ELVRRQYAQSWQKLQALSGPLAETLRRLGESAGTGIDVTALHNDLRRVLTVVSMPRRHGN
KKAQAKEMAALEAITNAILQDIKEKQNSQEGVPKMVQIVIYESSV
Download sequence
Identical sequences A7UTI7
XP_001688598.1.40869 AGAP004896-PA 7165.AGAP004896-PA AGAP004896-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]