SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP005076-PB from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP005076-PB
Domain Number 1 Region: 26-236
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.89e-54
Family BAR domain 0.0000000569
Further Details:      
 
Domain Number 2 Region: 287-356
Classification Level Classification E-value
Superfamily SH3-domain 7.48e-17
Family SH3-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP005076-PB   Gene: AGAP005076   Transcript: AGAP005076-RB
Sequence length 357
Comment pep:novel chromosome:AgamP3:2L:9657060:9693793:1 gene:AGAP005076 transcript:AGAP005076-RB
Sequence
MAENKGMLLAKSVQKHAGRAKEKLLQNLGKVDRTADEIFDEHLTNFNRQHTCATRLQKEF
SNYIRCVRAVQNASKSLMEAITEVYESQWTGSEVLYGQAKTIDTQYQQFSYKLADQVLKQ
LDTYALQFPEMKKKIDKRGRKLVDYDSQRHSFQSLQANAAKRKDDLKVTRGREQLEEAKS
TYEVLNSELHDELPALYDSRILFLVTNLQTLFACEQQFHSETSKVYAELEAIVDKLATES
QRGSYTLKKINANSNPSSPQQSPVKANLSIVNNVTNGSANANGRAATTDLPPGVLYRVKA
TYKYVREDVDELSFEVGDVINVVEYEDPEDQEEGWLMGNKEGTNEKGMFPANFTRPL
Download sequence
Identical sequences A7UT63
XP_001688482.1.40869 XP_001688483.1.40869 AGAP005076-PB|hypothetical AGAP005076-PC|hypothetical AGAP005076-PB AGAP005076-PC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]