SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP005257-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP005257-PA
Domain Number 1 Region: 365-598
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.8e-21
Family FCH domain 0.021
Further Details:      
 
Domain Number 2 Region: 782-835
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000179
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP005257-PA   Gene: AGAP005257   Transcript: AGAP005257-RA
Sequence length 901
Comment pep:novel chromosome:AgamP3:2L:13267022:13319286:1 gene:AGAP005257 transcript:AGAP005257-RA
Sequence
MYVIFPADELILLTYGIAVPRVPPRPTLDNLREPLVPTGSRPSSTTTTTTTSKNTTTVTT
SSTSNTTSSKHPSKSSKSTATKANTPANTKKANDSSKTGPSTAATAATTTTATTSAASNR
RQESGESYELDGPCGTTALADASELATFADDAGPRNGIPAAAAAGPLGAGRGGAAATAAS
PRGGPGKEPAAAGAPKSKSKLQLKLGRLRPHSSIEQSETASRVREDLHIHVSNPVFTRDN
LRQRNFDAFFESGEQVYSLEVREKPTPRSLDALGSSGSDPGLAEADGGLRAAAAGGYDQR
PSSLGFFRKPKSPLSIRSKSAEHEFADAETSQKGDDSMSTSGGGGVLKDLGHPGLNEALK
SHNGVTFKLVKTVSDFSETLAQLYEQHAEALQVLVSNYRKRNSELRKERPACQSNLFAAW
ETLLQEIEADSQATIDVASTLSRQVARPLLERSFYRKVQSRKVFTHRESFDTIISKTEEK
LSKCRIEYKQCYIAHRQSPTQHTLTQYIDSHNAYVQQLHATNAMLEAYHCETLPQLMQEL
EEIYNDLCNIVSEAVLQGAEAIAAKAAEQAKRYDGLAVQCKNVSPALDLGYFVRTLPVPQ
NNQRIPRKAFAPPQSANAPTDAGADDYPDYGGDELVVDRGATIQVRPSLEALRRESQELE
IQIKQLQDSVDALVRTQIRGIEGQLYSKANEIQEDISMKKFDVRAKQIHLAAVRAQKELF
LGRIDPGSPRGERKMSSSSSSSMKTKWLKAFRSLKPAVSTCTYAAVRFSNRSSGNGAQIR
FDGTDNHNLQEYTYKKITPCDVCSQVLRGHTRQGLRCRICKVNVHADCASQLPKCQVKQK
LLRRQKSTSEIENRATEVEEETEEDDIMISTRPFGQPLCFVVEEPPPEEMQSGKKDGKRK
K
Download sequence
Identical sequences Q7Q9E9
XP_314175.4.40869 7165.AGAP005257-PA AGAP005257-PA AGAP005257-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]