SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP005682-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP005682-PA
Domain Number 1 Region: 274-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000723
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 2 Region: 244-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000594
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP005682-PA   Gene: AGAP005682   Transcript: AGAP005682-RA
Sequence length 452
Comment pep:novel chromosome:AgamP3:2L:18725671:18740086:1 gene:AGAP005682 transcript:AGAP005682-RA
Sequence
MGRKLAHHLVLVGTLLLLAVESFSRAQAAANDYPAQQHQHLRNQQHHQHQHHHRHRTAEP
SRSRNQTSLNYALISGPGSVGNGGSDYRPPYQYPGTTGQQHWGNHHGNQPQHHHRETPPQ
HRRHHRGQAHPSHSQPSSPPGAAGWRRTSGNGGVPAARPVTRMLTRSGTVGSARHNNSTS
GKNVCTVHVYRKSVIKTYQGAPCRDPANCYGLRTYSAPVATREVCCRGWETTTTVADGCF
KPICQTPCRNGGRCTAPDRCTCPAGFTGKYCELDVNECKEHKPCDQTCYNTEGSYYCTCR
DGFMLQSDRQTCKKIGKLGHRGTPGAMEEKYATLNETNDLATEARDMENDLDVDYDSLDI
RLRKLEQLMASRDDRQELTKKVQYTMDAVSVLKSQVARLVSDFVYHFCFYNTELTLFCGS
CFYLSEPTTISTGGLWKSGSLGKPERMERTCF
Download sequence
Identical sequences Q7Q6T5
7165.AGAP005682-PA AGAP005682-PA XP_315695.4.40869 AGAP005682-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]