SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP006508-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP006508-PA
Domain Number 1 Region: 213-489
Classification Level Classification E-value
Superfamily Mitochondrial carrier 5.89e-81
Family Mitochondrial carrier 0.0000288
Further Details:      
 
Domain Number 2 Region: 28-188
Classification Level Classification E-value
Superfamily EF-hand 9.04e-37
Family Calmodulin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP006508-PA   Gene: AGAP006508   Transcript: AGAP006508-RA
Sequence length 499
Comment pep:novel chromosome:AgamP3:2L:33177521:33202561:-1 gene:AGAP006508 transcript:AGAP006508-RA
Sequence
MVNINRGPATGNDAGNEDRQAGGAASTPQYPQYLHELPQADEERLERIFKKLDRDGNDRI
DIHDLSAALKEFGLSHQYAERFLKQSDQNQSGDVGLAEFIHYVREHEKNLRLQFTHLDKN
QDGKVDLEELITAFKELGIEMDQHEAAKLLKRMDKDGSLNISYDEWRDFLLLAPSSDIHE
LVKYWRHSTYLDIGEDLNVPDDFTQSEMQTGMWWRHLAAGGIAGAVSRTCTAPLDRLKVF
LQVQASKQRISDCLQYMLKEGGVRSLWRGNFINVLKIAPESAIKFAAYEQVKRLIRGNDK
RQMTIYERFVAGACAGGVSQTAIYPMEVLKTRLALRKTGEYSSILDAASKIYRREGLRSF
YRGYIPNMLGIIPYAGIDLAVYETLKKKYLSHHETEQPSFWLLLACGSASSTLGQVCSYP
LALVRTRLQAQAVTIGPNPDGSVAVEPNMTNVFKRIIQTEGPVGLYRGITPNFIKVLPAV
SISYVVYEYTSRALGVNMT
Download sequence
Identical sequences Q5TQV7
7165.AGAP006508-PA XP_557186.3.40869 AGAP006508-PA|hypothetical AGAP006508-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]