SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP007173-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP007173-PA
Domain Number 1 Region: 177-254
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000225
Family DEATH domain, DD 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP007173-PA   Gene: AGAP007173   Transcript: AGAP007173-RA
Sequence length 255
Comment pep:novel chromosome:AgamP3:2L:43821855:43822849:-1 gene:AGAP007173 transcript:AGAP007173-RA
Sequence
MERISVQDHRAVYERLCKDYLNLKLLAQNACHGPERLERCKQSVRQDIHSCRKLSRITQF
EQLVALMEQRNLVSLLKPDLIERFVLALDTKEVGGALTSYRNVLRSHYEPVRRFYLEDLR
HRDRRTLLEKEVERIKLQESTEPPAVTPRPPTATTNAKRDAYLRQREGIYSLLQLEIGKS
WKVFGRFLNVPAGELDEIEERNRQDLKTRIYETLEWAEMQYDDAALDQYVGVLLKALESS
RRKDLKRKIETMLQR
Download sequence
Identical sequences Q7QJ06
AGAP007173-PA 7165.AGAP007173-PA AGAP007173-PA|IMD XP_308597.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]