SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP007924-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP007924-PA
Domain Number 1 Region: 2733-2851
Classification Level Classification E-value
Superfamily Cadherin-like 4.97e-32
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 1414-1543
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-29
Family Cadherin 0.00098
Further Details:      
 
Domain Number 3 Region: 1850-1953
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 1209-1313
Classification Level Classification E-value
Superfamily Cadherin-like 8.51e-29
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 2312-2425
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 440-544
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-27
Family Cadherin 0.0027
Further Details:      
 
Domain Number 7 Region: 4047-4269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.91e-27
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 8 Region: 3162-3273
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-26
Family Cadherin 0.0007
Further Details:      
 
Domain Number 9 Region: 546-652
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-26
Family Cadherin 0.00076
Further Details:      
 
Domain Number 10 Region: 3478-3589
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-26
Family Cadherin 0.0028
Further Details:      
 
Domain Number 11 Region: 3583-3692
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-25
Family Cadherin 0.00081
Further Details:      
 
Domain Number 12 Region: 872-980
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-25
Family Cadherin 0.0032
Further Details:      
 
Domain Number 13 Region: 2202-2318
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-25
Family Cadherin 0.00051
Further Details:      
 
Domain Number 14 Region: 1315-1418
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 15 Region: 1950-2053
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-24
Family Cadherin 0.001
Further Details:      
 
Domain Number 16 Region: 3267-3377
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-24
Family Cadherin 0.00086
Further Details:      
 
Domain Number 17 Region: 2418-2523
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 18 Region: 210-339
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-24
Family Cadherin 0.002
Further Details:      
 
Domain Number 19 Region: 981-1085
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-23
Family Cadherin 0.0015
Further Details:      
 
Domain Number 20 Region: 2095-2200
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-22
Family Cadherin 0.00086
Further Details:      
 
Domain Number 21 Region: 1750-1856
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 22 Region: 4305-4345,4384-4547
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.49e-22
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 23 Region: 2842-2948
Classification Level Classification E-value
Superfamily Cadherin-like 6.94e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 24 Region: 3370-3476
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 25 Region: 2942-3051
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-21
Family Cadherin 0.0018
Further Details:      
 
Domain Number 26 Region: 1081-1207
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 27 Region: 329-440
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-20
Family Cadherin 0.0043
Further Details:      
 
Domain Number 28 Region: 102-222
Classification Level Classification E-value
Superfamily Cadherin-like 2e-19
Family Cadherin 0.0024
Further Details:      
 
Domain Number 29 Region: 3047-3163
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-18
Family Cadherin 0.0019
Further Details:      
 
Domain Number 30 Region: 2518-2628
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-18
Family Cadherin 0.0016
Further Details:      
 
Domain Number 31 Region: 654-754
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-18
Family Cadherin 0.001
Further Details:      
 
Domain Number 32 Region: 2641-2744
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-16
Family Cadherin 0.0036
Further Details:      
 
Domain Number 33 Region: 1527-1631
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000357
Family Cadherin 0.0029
Further Details:      
 
Domain Number 34 Region: 814-884
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000286
Family Cadherin 0.0045
Further Details:      
 
Domain Number 35 Region: 1644-1748
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000443
Family Cadherin 0.0044
Further Details:      
 
Domain Number 36 Region: 21-108
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000443
Family Cadherin 0.0066
Further Details:      
 
Domain Number 37 Region: 3993-4029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000167
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 38 Region: 3952-3992
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000122
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  AGAP007924-PA
Domain Number - Region: 3683-3792
Classification Level Classification E-value
Superfamily Cadherin-like 0.00746
Family Cadherin 0.02
Further Details:      
 
Domain Number - Region: 3932-3955
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0158
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP007924-PA   Gene: AGAP007924   Transcript: AGAP007924-RA
Sequence length 5159
Comment pep:novel chromosome:AgamP3:3R:2856038:2897703:-1 gene:AGAP007924 transcript:AGAP007924-RA
Sequence
PRRRSSSDGAMQSRAVETRVQFNVFENEAKGTVVGYIPTKPGFTYRFNEPPREFVLDAST
GEIKTNAVLDREALRADRYDLVILSSQPTYPIEVRITVLDVNDNAPEFPEPTIAVSFSES
AITGTRLLLDAATDRDAGENGVTDDYRIVEGNHEEKFRLAVTTSPNGDVYYLHLETTGKL
DRESRGFYALNISARDGGEPARYGYLRVNVTILDVNDNPPIFDHSDYIVSLNESVLPGTP
VLQVMASDSDLGDNSKITYYLADAETQFTVDPETGVIATTEQLTCPHQNCHEGGRSCPKS
CVFTVFARDHGTPRQDGRTYVTVNLVDTNDHDPVIRFQYFPPTGSFATVDENAANGSVVA
AVSVVDADEGLNGDTSLRIVAGNDLQHFRLEKSPSFYIVRVNGVLDREEIGKYNLTVVAI
DRGAPPRTATAHLIIHVNDVNDHEPVFEKSEYSAVLSELAPPGTYVASITATDEDTGVNA
QIFYDFVAGNRDQWFRIDPASGLITTRAPLDREVLGHVELSISARDGGPNPKWAHTQLKV
TILDENDEAPAFAQPLLNVTLSETAPPRTVVVSLAAVDHDQGTNGSITYSFHPSVERNYP
GTFELDALSGQIATRRALDRELVAAYTLVVIARDHGSPPQSSSATVSVAVEDANDNSPEL
YPRAFFVPVAEDAPEGTLIAQLTATDRDEGENAIVQYELVGGPTTDAALFAIDATTGALT
LRSSLQKSPKPVHRVIVGCKDRGGRRAEQDAVVEVVKESLVEEIGFDAPSPSGYDFRLLE
DNGLERRQKSPQEREVGQLRTRWAAASGSASAGSSNVVFAIVRGDSAASFRIHERTGVIS
TARHIDREQRALYRLTVAARNGLAYGETTVNVTVVDVNDNAPAFLYEHDEIRLPENAAVG
QEVYVAKAKDADTGANSQVRFGLSSNPEGLFRIAETSGVIYLNRSIGVEPGTVLSLEVSA
TDGGSPPLTTRTTVQVTVEDVNDHTPVFDHTSYETSLLESMPVNSRFFALAASDADVGPN
GRISYAIVEGNVDGKFGIFPDGYLFVRSALDREERDYYALTIACADEGRPVSRSSSVPVI
VHVIDENDNAPQFTNGTFVFSVAENEPPDTFVGKLTAIDRDIGRNAELIYTLSSTSSTSS
AGGSSASGKDREEDFSIDSRNGFIRTRRSFDREALGGQSFLALEATVSDNGAVRLRDRVK
IKVFITDVNDNAPVFVRAPYRVQISEGASIGTQLVRVYTHDADEGLNGDVFYYISEGNRA
ERFAIDDSTGQITLARALDRETTASYRLTVVAHDASKQHRLSASTTVTIEVLDENDDAPE
FTQTLSQIAIVETTPIGTELMRFRATDLDLGANAQIAFSIAAGNRRDTFHIDALSGALYL
HRALDYEDTQSYSLNISAADGGNPRLATTILFAVNVIDANDNPPAFPNTAIVRQIREGIP
LNTPIVTVTAEDPDSGLNGKVRYEIAHQDPQDGDGERHFGINPTTGVIHTLHLIDREAID
TYRLTVLATDQAAPPAQRLSAEKLVTVIVEDVNDNAPVFVSMNAAILPVRDSAMGEIMRI
HAQDADSSSNGLVTYEMIGGNTDIFQLHRTTGVITLRKPIPKPDTRYQLSVRATDEAVQA
ERKSSDAYITILTTGAPGSSSSGPVFAKKDLSGSVSENEPIGTSILTVSAYLNSVSDIEY
YVTNVTSGSNGRQVNRLFDIDTKLGILSTAAELDREAGIEHYDVEVYAVAVGTVPRTTST
RIRVNVLDKNDSPPKFQNLPLVFSVSEDLAVGQTVARITATDPDTLGKLEYALLDGDAPK
KFALERETGLLKLRDTLDRETEDSYRLKVSVTDGIQSTETTITIQITDTNDNPPVFAEPA
YSFDIPENAQRGFHVGVIAATDPDVGTNAAVTYTVISDWANDVFSLNPQTGIFTLTARLD
YEEVQHYILVVQAQDNGYPSLSSTLTVYCNVVDLNDNAPIFDPMSYSNEIFENAPINSDV
VTVSATDIDSGSNGRIEYSITAGDDNEDFQIMSNGTIRTRRALDRETKSSYSLVVTARDC
AKEPEKRLSSTVQVAAADCCKILHTFTLSCSSYHHHSTYLSHATHTQVTIVLKDINDLAP
EFVTPNETSVAENIPPNTVIMAIKAVDRDEGRNGYVEYQLEDDQGSLPSPFTVGQADGLL
RVSGQLDREAKPSYELNVIAKDRGDPPRMTQSRIRINVLDENDNSPIFDPKQYSAAIAEN
ASIGASVLQVSATDIDEGANGRVRFSIAAGDDNRDFTISEDSGVVRVAKNLNFERKSLYA
ITVRAEDCAGDTENGEVRFDTARLSITITDINDNPPTFLDSPYLAYVMENVIPPNNGYVI
TVRAYDADTPPFNSQVRYFLKEGDTDFFKINASTGEISLLRALDREMQEEYILTLVAMDT
GSPPLTGTGTVRVMVQDINDHNPEFERQSYQATIAENQPIGTRVLWPRATDRDAGLNAKI
RYTLLGEHSSRFRLDASSGEITTAAVLDCEDMPIYHFTLMAQDSSTTEPRATLVNLTIDV
QDVNDNSPAFGAPTFHVNVPDRIKPGQFVFGAKAIDRDEGVNARLLYSIVGTDAAKFRIN
EHTGVIEAATELSTPMSGANSERVFRLTIVAKDEGYEPRSATCELAISLRSAHLFPVFSY
TSETQFVLPEDIADGKMVTKLAATSPKKGSVGTIRYAIAGGNIGEALRIDPSTGEVAVNR
GGLDYERHQQYEVWIEAADSDRPSLRSVLQLIVNVTDANDNAPVMDRPMYVAEVLEEESP
SQLVTKVSASDADSEENGQITYRLRDDFESFEINTDTGEIYTTTRLDREDIAQYTLIVEA
VDQGVPQLTGSATVLVNVLDKNDNPPKFTRLFSVNVTENAEIGQFVIKITSSDSDVGVNA
NATYIFTENLGGKFSIDSTTGNVTVAGHLDREQQDEYILKVAAVDGAWRTETPLTITIQD
QNDNAPEFEHSYYSFNFRELQKSVTFVGQVIATDRDKQGPNSVISYSLQQPSDLFTIDPA
TGEIFSKRRIHYKHTQLEASPENSFTLTVLATDNGKPPMYTECLVNINVVDANNNPPVFS
QRAYMAPVPEGADVGLRILQLTARDELDFGVNAEIEYQLIGGNGSDRFAINKLDGWIVVG
RKLSEVAASPGTVFVLQVRAVDRGVPPQQDEVSVTLIVTGANRFAPVFQSPSYQVIVPEN
EPIGSTILTVSAPDNDDGPNGMVRYAILAGNERNDFMVNSVTGAVSIRNPLDYDLIQVYQ
LNITAEDLGYKPKRSIAMVTITLTDINDNAPYFNQSVYDAYVAENSPANTFVYRAQAHDR
DSPKNAIINYAIVGGSGRELFAIETATGIITSKATFDYEEQDQYTLTLAAYNPDSSMRNE
TKVIVHVTGVNEYFPKFIQPVFHFDVSESAEVGSSVGIIEATDKDAGEDGKVYYLLVGSS
NDKGFSIHPSTGVLVVSRNLDRETQSRVVLTVLAKNYGGIRGNDTDEAQIIISIQDGNDP
PEFQRDLYEASVSEGDPIGTKVIVVKAVDKDVRPQNNQFSFSIIGGNNDHSFKIDPQSGQ
IETARKLDRETVPTHKLLLGAIDTGTPPQTGTTVVRITVTDINDNGPTFDPKDTIGAVLE
NEPPNTVVMTLAATDPDLPPNGAPFTYQLVGGRHKSLFTLERHSGVLKTVRSLDREQTPQ
LELLVVVEDNGKPRKRTQHTITVNVLDQNDSPSTPRNVHVLVYAFREGPLHGDIASVHPN
DPDVTGDYRCKLLTDTNKQPVTTFTISSGCQLRLTNANRIPTSGHTFLVSGNDGKHPDVT
STVSVEFLHFDNATVDQSITVRLENISSANFLANYYRNFVDIVKASLEPADDLILYSLLD
AGKALHVTLAVRNTPLKGYRSKQYVIERFSRKLEAIGQLLPNVQTTIGYDPCRSADTCAN
GGVCSARIKVYPEEDNRITDSQSLIFTSPPVRHDFACACPDGYTGARCDKRQDPCSPNPC
HAGGQCRRQGYDFQCTCPSNREGKYCQLERGDICSSGPCKNGGSCRESSDGSSFFCLCRP
GYRGNQCEAVADSCRPNPCLHGGLCVSLKPGYKCSCVEGRYGRHCEKTTFGFRELSYMAF
PALDSATNDISVVFATTKPDALLIYNYGIQSGGRSDFVAMEIVNGRAVFSYGGARTAITS
LVVGQSTSTASGRNGSISNGEWHKITATRNGRVMSLSVSKCTDNGDYCDDCRPGDSSCYA
DDTGPTGTLNFNKHYLLVGGLMAADPVLERPGQVHSDDLVGCVHSVSINGRALNLSNPIK
SFGIESTCQRSTGSSGPCGLGLPEDPAQPLCGPYGQCMDRWHTAMCRCGGAILSPDCYSS
LDAYSLQDGAFIEFEITEKHKRMQLLESIYSGKSWIWSYDVTRSKRHEGHVAPTLTIAED
PPKYMSILFKTNKPSGVLIYAATSSKHYTAIELRNGRLSYTSHQTSFVNVSASAGGGQDG
SSLADGNWHNVTLHSHNRVLQVLVDGRMVMPELDATGVHDFLDPYLTVLAIGNVRREYFS
ASETEPMPAYFQGCLANFTINGEVQPFNGSGSIFRSVVHRGNVAQGCAWSVLGTAQVTNP
LNIGITLVIVFFVMLLIGIFISFLVVRCRRQHKEKSGALGHSSAALHSKQNGTGGSTLLA
GSGMVSSGGLHGDGGGRGMHANDLSVVGYHSENSDMLRGVSGHHLVGPELISKKYKERDL
AATEPQRPQRPDIIEREVVSKSPPLPPPSQSHHPSAPHDHTNNPSSMDLGSEYPEHYDLE
NASSIAPSDIDIVYHYKGYREAGGVRKYKATPPPVATAYTHHKHQTSAAAAQQQHRHSPH
HAAAGGPYAPRVLPPPQASQPPPSNGAAHARQHQSTPLARLSPSSELSSQQPRILTLHDI
SGKPLQSALLATTSSSGGVGKDALHSNSERSLNSPVMSQLSGQSSSARSRSKNPGGVPSQ
PPNVVSVSSVVVPVGHGGMGLTAEEIERLNARPRTSSLVSTLDAVSSSSEAPARVPAPHL
SHMHHSPADIDAHSSTSTDESGNDSFTCSEIEYDNNSLNGDTGATNNGVVGPGGGGGGCV
NGTGGGGGGGKGAPHLPPASSYDGFDSSFRGSLSTLVASDDDLSSHMVGIYRQPNGGGAA
SPSATGWDYLLNWGPNFESLMGVFKDIAELPSDVTVNGRVPNSLRIPTGVQSKPSEEYV
Download sequence
Identical sequences Q7Q3K5
AGAP007924-PA 7165.AGAP007924-PA XP_317558.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]