SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP010750-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP010750-PA
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 5.62e-39
Family MIR domain 0.0027
Further Details:      
 
Domain Number 2 Region: 1079-1179
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-21
Family SPRY domain 0.02
Further Details:      
 
Domain Number 3 Region: 4186-4245
Classification Level Classification E-value
Superfamily EF-hand 0.00000000226
Family Polcalcin 0.041
Further Details:      
 
Domain Number 4 Region: 665-800
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000514
Family SPRY domain 0.077
Further Details:      
 
Domain Number 5 Region: 98-181
Classification Level Classification E-value
Superfamily MIR domain 0.000000471
Family MIR domain 0.025
Further Details:      
 
Domain Number 6 Region: 2245-2329
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000445
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Weak hits

Sequence:  AGAP010750-PA
Domain Number - Region: 1510-1634
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000435
Family SPRY domain 0.064
Further Details:      
 
Domain Number - Region: 3077-3305,3405-3456,3595-3648
Classification Level Classification E-value
Superfamily ARM repeat 0.0053
Family Armadillo repeat 0.056
Further Details:      
 
Domain Number - Region: 464-630
Classification Level Classification E-value
Superfamily ARM repeat 0.0127
Family GUN4-associated domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP010750-PA   Gene: AGAP010750   Transcript: AGAP010750-RA
Sequence length 5109
Comment pep:novel chromosome:AgamP3:3L:9789482:9818643:1 gene:AGAP010750 transcript:AGAP010750-RA
Sequence
MAEAEGGSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDLS
QCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHNNSDMYLACLSTS
SSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
NDLSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWSLDSG
QNIVVYEGGSVMSQARSLWRLELARTKWAGGFINWSHPMRIRHLTTGRYLGVNENNELIL
MSRDQATTSQTAFVLRLEKDDQKVVLEDKDLEIIGAPIIKYGDSTVIMQHYESGLWVSYK
SYETKKKGVGKVEEKQAILHEEGKMDDGLDFSRSQEEESRTARVIRKCSSLFTKFISGLE
TLQENRRHSIFLQTVNLGEMVMCLEDLINYFAQPEDDMEHEEKQNRLRALRNRQDLFQEE
GVLNLILEAIDKINVISSQGFLASFLASDESGQSWDMISGYLYQLLAAIIKGNHTNCAQF
ANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRD
PKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTGLVDHVASIRPNIFVGRVEGS
AIYQKWYFEVTMDHIEQMTHMTPHLRIGWANTAGYVPYPGGGEKWGGNGVGDDLFSYGFD
GVYFWSAGRRTCVVPREVTEPFIKKGDVIGCTLDLSVPVIRFTFNGEPVQGCFTDFNLDG
MFFPVMSCSSKLSCRFLFGGDNGRLKFNPPPGFSPLVQCLMPHQNLSLDPCFYFGNLNKN
VLAGPWLVEDDSAFVPKPVDTSIVTLPSSVETIKDKLAENIHEMWALNKIEAGWTWGERR
DDVYRIHPCLTSFEKLPAAEKRYDCQLAVQTLKTILALGYYISMDKPPARIRPIRLPNDP
YMQGNGYKPAPLDLSAAVLTPKMEELVDQLAENTHNLWAKERIQQGWTYGLNEDSENLRS
PHLVPYSKVDEAIKKANRDTASETVRTLLIYGYNLDPPTGEANEALAAEALRQKFAAYRT
YRVERTYAVTSGKWYFEFEVLTAGPMRVGWARADCNPGTMLGSDDASWAFDGYNEEKVSG
GATESFGKQWVPGDIVGVFLDLVDHTISFSLNGELLMDALGGETTFADVNAPDGVGFVPA
CTIGIGQKARVVYGQDVDSLKWFTTCGLQEGYEPFCVNMKRPVTHWYTKDQPIFENTDEI
PECKIDVTRIPGGADTPPCMKISHNTFETMEKANWEFLRLSLPVTCANTFITEQEKMRRW
EEIRIRQHRLMTEVDHSAPAHFDHIMRSGFTMNDIKGLHRNYSEDAAEADEMMRNGPRRP
SRHQGRGGLSPPGIEINGEATSDGELNAYSDNELEGGDDRKKRGRSPFRLFGKKRDQSKD
KLKDRRTPEPEPRKSNLKVTQRGQATRMSNSDLRAQAPLTPERKGMGSPQVESFGNEVYD
ADCLRLINEYFYGVRIFPGQDPTHVYVGWVTTQYHVHSKEFSQNKVRHAAIYVEDENEKT
IEIVNRQSCYMVRADELFNEVTQDSSGKGASQGMFVGCFVDTATGTIRFTCEGKETSHVF
LMEPDTKLFPAIFVEATSKEILQIELGRTPTTLPLSAAVLPTSDKHINPQFPPRLKVQCL
KPHQWARVPNTALQVHALKLSDIRGWSMLCEDPVSMLALHIPEEDRCIDILELIEIDRLL
QFHAHTLTLYSALCYQSNYRAAHALCSHVDQKQLLYAIQSEYMSGPLRLGFYDLLISLHL
ESHATTMEVCKNEYIIPLGSELRELYIDPEMCHSLRSLQTLSVRPEMNMTEIAPTPSQSN
MPTIVAPDSSSEPIPAIDSLYSPRFPLEVVREFVMSALQEAVQINQVHNRDPIGGSNENL
FLPLIKLIDRLLLVGVITNEDVEKLLIMIDPETWDPSFEKEGRDEHRKGLLTMKMAEGAK
LQMCYLLHHLYDVQLRHRVESIIAFAHNYVGDLQQDQLRRYIEIKQSDLPSAVAAKKTRE
FRCPPREQMNAILGYKNLEEDDLENASCGPELRNRLIEFHEKLMGKVSLNALQEPEEPEA
DKLEEGRPGAMKKLYNFINAVKELEEDPKEPVEEEKKTPEEVFRKVLIKQLVSWAEESQI
ENPKLVREMFGLLVRQYDTIGELIKALNKTYVINSKTKGDVANMWIGLSQIRALLPVQMS
QEEEELMRKRLWKLVNNHTFFQHPDLIRILRVHENVMAVMMNTLGRRAQAQSDAPVQTAD
GEESAPKEKDTSHQMVVACCRFLCYFCRTGRMNQKAMFDHFDFLLENSNILLSRPSLRGS
TPLDVAYSSLMENTELALALREHYLEKIAIYLSRCGLQSNSELIERGYPDLGWDPVEGER
YLDFLRFCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLLKAIVDANKMSERIS
ERRKMQDEAEGTITGLNFSHPLPEGDDDEDYIDTGAAILCFYCTLVDLLGRCAPDAAVIE
QGKNESLRARAILRSLVPLEDLQGVLSLKFTLTNPALGEDRPKSDMPSGLVPGHKQSIVL
FLERVYGIETQELFYRLLEDAFLPDLRAATMLDRSDGSESDMALSMNRYIGNSILPLLIK
HSKFYNEAENYASLLDATLHTVYRMSKNRMLTKGQREAVSDFLVALTSAMHPAMLLKLLR
KLTIDVSKLSEYTTVALRLLTLHYERCAKYYGTTGGGQASQFGASSDEEKRLTMLLFSNI
FDSLSNMDYDPELFGKALPCLIAIGCALPPDYSLSKNSDDDLYGKPTGGGPDQPHYNPQP
IDTTAVQLTNDLNQIVQKFSEHYHDAWASRKLENGWTYGDQWSDANKTHPRLKPYNTLSE
YERERYREPVRESLKALLALHWRIEHSEGDVPLSNRGSMRRQSKPNLELQGDTGSPFNYN
PHPVDMTNLTLSREMQNMAERLAENSHDIWAKKKNEELDQCGGAIHAQLVPYDLLTDKEK
RKDRERSQEFLKYLQYQGLKLHKPSRGQTEEPGMSTAAIELRFAYSLLEKLISYSDRATI
NMKLLKPSSTFSRRSSFKTCSRDIKFFSKVVLPLMEKYFSSNRNYFIAIATATNNVGAAS
LKEKEMVAGLFCKLASLLRHRLAAFGADVRITVRCLQVLVKSIDAKSLVKNCPEFIRTSM
LTFFNNTADDLGQTIVNLTDGKYDRLRGTHLKTSTSLAYVNQVILPVLTSLFDHLAACDY
GSDLLLDEIQVASYKILSALYTLGTDTSLTRDRKYLKTELERHKPALGSCLGAFSSCFPV
AFLEPHANKHNPFSLLNRIADTSLEAQDIMSKMESCMPTLESILSEVDQFVESEKTYQEA
QHIIDVILPLLCSYLPFWWNQGPDNVSPQSGNHVTMVTADHMNHLLKNVLKMIRKNIANE
NAPWMTRIATYTQQIIINSSEELLKDVFLPLAERVKKRCDSMFHKEESLRGFLKSSTDDT
SQIEAQIQEDWQLLVRDIYSFYPLLIKYVDLQRNHWLKDNVAEAEELYNYVAEIFNVWSK
SQYFLKEEQNFISANEIDNMTLIMPTATRRSAAVSGDMPASGGKVKKKKRSRDKKRDKDK
EIQSSLMVACLKRLLPVGLNLFAGKEQELVQHCKDRYLKKMPEYEVIEFARTQLTLPDKL
DPADEMSWQHYLYSKLGKKEQIVQDTLEKSDKKPENKIEDTVERIVAMAKVLYGLHMIDH
PQQQSKNVYRSCVSIQRKRAVIACFRQVSLHSLPRHRACNIFARSYSELWLEDENTGQEV
MIEDLTQTFEDAEKKKKDEEEEEGKPDPLTQLVTTFCRGAMTERSGALQEDPLYMSYASI
VARSCGEEEEEGGDEEEGAGEDEGGASIHEQEMEKQKLLFHQARLANRGVAEMVLLHISA
SKGVPSEMVMRTLELGIAVLRGGNIDIQMGMLNHLKEKKDVGFFTSIAGLMNSCSVLDLD
AFERNTKAEGLGVGSDGAAGEKNMHDAEFTCALFRFIQLTCEGHNLDWQNYLRTQAGNTT
TVNVVICTVDYLLRLQESIMDFYWHYSSKELIDPAGKANFFKAIGVASQVFNTLTEVIQG
PCTQNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQKDMITMMLSML
EGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLKDLTSTPSFMEIDSNGDGWIMPK
DFREKMEQQKSYTPEEIDFLLACCETNHDGKIDYIGFVDRFHEPAKEIGFNLAVLLTNLS
EHMPNEPRLARFLETAGSVLNYFESFLGRIEIMGSSKRIERVYFEIKEANIEQWEKPQIK
ESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHASGLMASDDDGGTVRRDQAFTYIS
EEEEERAARDPIKRTIQAVKDGLSYSMYMISPSNIKHQITVLQSKSFPEIIVGFFKMIFY
AFYYSGFGVSVVIKYLVNILMSLMRGPAQEEEEPIPEAEPSLRALPPLPLEEPPGTVQAF
GLDISKEENGQYRMAPHESPALSPSSSIEETGESSPEDGAAELTGEGVPPGEQMTLVDLL
GGEAAKRAAQERTEAQKAQEATLASIEAESKKASTETKEPAAVHQIDFSKYTKKCVSYLA
RNFYNLKYVALVLAFCINFMLLFYKVTTLGDDEDGEGGSGESLMGLGSGLGSGLGILETG
SGGGEGGSGDGEGEEEDPPEKVHVDEDFFYMEHVLRIAAILHSLVSLCMLIAYYHLKVPL
AIFKREKEIARRLEFDGLFIAEQPEDDDIKSHWDKLVISAKTFPVNYWDKFVKKKVRQKY
SETYDFDSISNLLGMEKTAFAAQEANEGGGFFHFITNIDWRYQIWKAGVTITDNSFLYSL
WYFSFSVMGNFNQFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVMLLTIIVYIYTV
IAFNFFRKFYVQEDDDGEEGDRKCHDMATCFVFHLYKGVRAGGGIGDEIGDPDGDEYEVY
RILFDITFFFFVIVILLAIIQGLIIDAFGELRDQLESVKEDMESNCFICGIGKDYFDKVP
HGFDTHVAQEHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRCWDFFPVGDCFRKQY
EDELGGGGS
Download sequence
Identical sequences Q7PMK5
AGAP010750-PA 7165.AGAP010750-PA AGAP010750-PA|hypothetical XP_318561.3.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]