SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP011322-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP011322-PA
Domain Number 1 Region: 601-745
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000121
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 461-607
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000298
Family Growth factor receptor domain 0.0078
Further Details:      
 
Domain Number 3 Region: 281-419
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000282
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 165-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000779
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 220-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000839
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP011322-PA   Gene: AGAP011322   Transcript: AGAP011322-RA
Sequence length 866
Comment pep:novel chromosome:AgamP3:3L:21051375:21061201:-1 gene:AGAP011322 transcript:AGAP011322-RA
Sequence
AIEQILSLCCQEGEEWGLQSRTCSSFNKSLELVPAGLHGLCLSTIEICCSKQHKIYQCTA
GQIAARQGLSCSLKGDHSGSEFYTDCCEACKIGLVVGSSANKCSVEPFAFGSPWDEIYDA
CCNDIKKEGEIILLSGNDERECLFARVFFFSHTFASLLLRLRHLLCEQFPSICSQVCENV
EGGSYVCKCHPGYELLDDRKTCALSKASFCDAGFKHNKRTDKCEDVNECETGEATCNPDS
QVCRNTRGSFLCVDVVLPDIACDPGYTPKNGKCEGKKKVETCTPGFRRHNDQCVDIDECA
ADRNACDSNQVCTNEIGGFRCDCKIGFNLDTVTNACVDINECQVNAHECLETQRCDNTIG
SYTCIRLQSCGTGYTLNAETGHCDDDDECALGRHNCRPPFECFNTKGSFRCRQLSRYHTL
TSTSTSTTTSTTTVRPSYNPAGYGHYPASRYSSYQPQLPPCGIGFERNSAGACVDIDECA
RGASCHRHQQCINTNGSYRCRDLLTCPVGYRVNDDITECLDIDECATGEALCGPDQTCKN
KKGGYVCVCPPGHMIGRNKRCEDIDECAMHGSKVCQQNSNCVNTIGSYRCDCKEGFKNGP
NEMICTDVDECKEIPGLCHQRCLNYWGSYRCGCHPGYRISYNNRTCDDVDECEEYKSANL
CVGICENTPGSYSCRCPHGYKLGADGRSCIDIDECETGDVCRGRQDICTNIGGSYRCTTI
DCPYGYKHDPDRRNRCERSNKYCNTGDMECLRRPHSYSYNFLTIVSNILIPPEGRGLFTL
TGPSHFQMIDFDLKLVSVDAAPHVKPVDIHYFGLEKRTNDAQLNLKKSIEGPQDIELELS
MSVFHNGELYGTNVAKLFLMISAYEY
Download sequence
Identical sequences Q7PSQ4
XP_309330.4.40869 AGAP011322-PA|hypothetical AGAP011322-PA 7165.AGAP011322-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]