SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP011936-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP011936-PA
Domain Number 1 Region: 163-471
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.68e-39
Family NodB-like polysaccharide deacetylase 0.014
Further Details:      
 
Domain Number 2 Region: 60-101
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000209
Family Tachycitin 0.018
Further Details:      
 
Domain Number 3 Region: 118-154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP011936-PA   Gene: AGAP011936   Transcript: AGAP011936-RA
Sequence length 537
Comment pep:novel chromosome:AgamP3:3L:35354466:35367736:1 gene:AGAP011936 transcript:AGAP011936-RA
Sequence
MVKLLALIGILALTVAAATAEVRIKRQAEETTKKEESFEKELCKDKDAGEWFRLVAGEGD
NCRDVIQCTSSGLQAIRCPAGLYFDIEKQTCDWKDAVKNCKFKNKERKVKPLLITDEPLC
QDGFLACGDGNCIERGLFCNGEKDCSDGSDENSCDIENDPNRAPPCDESVCQLPDCFCSE
DGTTIPGSLPAKDVPMMITITFDDAINNNNIDLYKEIFNGKRKNPNGCDIKATYFVSHKY
TNYSAVQETHRKGHEIAVHSITHNDDERFWSNATVDDWAKEMAGMRIIIEKYANITDNSV
VGVRAPYLRVGGNNQFTMMEEQAFLYDSTITAPLSNPPLWPYTMYFRMPHRCHGNLQSCP
TRSHAVWEMVMNELDRREDPTNDEYLPGCAMVDSCSNILTGDQFYNFLNHNFDRHYDQNR
APLGLYFHAAWLKNNPEFLDAFLYWIDEVLANHNDVYFVTMTQVIQWIQNPRTTNEVKNF
EPWREKCVVEGQPACWVPHSCKLTSKEVPGETINLQTCVRCPNNYPWVNDPTGDGFF
Download sequence
Identical sequences A0A182II05 A0A182L576 A0A182XU93 Q7PZI8
AGAP011936-PA XP_320597.3.40869 7165.AGAP011936-PA AGAP011936-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]