SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000009583 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000009583
Domain Number 1 Region: 46-132
Classification Level Classification E-value
Superfamily Homeodomain-like 1.6e-27
Family Myb/SANT domain 0.0003
Further Details:      
 
Domain Number 2 Region: 7-53
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000079
Family Myb/SANT domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000009583
Sequence length 132
Comment pep:novel group:AMEL2.0:Group1:10768835:10771180:-1 gene:ENSAPMG00000005515 transcript:ENSAPMT00000009583
Sequence
DAVLKQLVSNAEQLGTGLRWDAIASHFPDRSDVQCQQRWAKVVNPELVKGPWTKEEDEKV
VELVERYGPKKWTLIARHLKGRIGKQCRERWHNHLNPGIKKTAWTEAEDRIIVEAHRRVG
NQWAKIAKLLPG
Download sequence
Identical sequences ENSAPMP00000009583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]