SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000010917 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPMP00000010917
Domain Number - Region: 9-48
Classification Level Classification E-value
Superfamily IpsF-like 0.0366
Family IpsF-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000010917
Sequence length 122
Comment pep:novel group:AMEL2.0:Group6:12421342:12424295:-1 gene:ENSAPMG00000006304 transcript:ENSAPMT00000010917
Sequence
FPGVYTVQGHGIHSHEIAIPRKVSERGVLISHNVTHHHHEDGPVVHYRLSVAGNEYHIEL
AAVEKFIGPGLVVERRKRDVHVRARPKNSSSKCHYRGFIRGHANSRVALSACDGLDACIG
AI
Download sequence
Identical sequences ENSAPMP00000010917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]