SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000012542 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000012542
Domain Number 1 Region: 161-366
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000249
Family RNA methyltransferase FtsJ 0.035
Further Details:      
 
Weak hits

Sequence:  ENSAPMP00000012542
Domain Number - Region: 541-630
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 0.0201
Family mRNA capping enzyme 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000012542
Sequence length 746
Comment pep:known group:AMEL2.0:GroupUn:1260975:1263336:-1 gene:ENSAPMG00000007192 transcript:ENSAPMT00000012542
Sequence
VNEELNKQESKNLNTDKVKRMMKKMGYKEGYGLGKNKQGRLEPVEASKQHGRRGLGHNIP
GLEASSLKWDPAEEEIKCKEDMEWIKNSNKNLPTKEEMHFWLQIGPKKMTIDDETQFCHE
DIVRNIINSKTVFDNLDDVEFRRARTRSNPYETIRGAFFLNRAAVKMANIDRACNFMFTD
RKHLGKNELLYFADVCAGPGGFSEYVLWRTKWHAKGFGFTLKNENDFKLADFYAGSPETF
HPYYGPKDNGDVFDSENQRTFRELIMKYTHNKGVHFMMSDGGFSVEGKENLQEILSKQLY
LCQCLVALMIVREKGHFVTKLFDIFTPFSAGLIYLMYRCFDEICIFKPNSSRPANSERYL
ICKSKRPGTEIVMQYLNKINHLLLDSDENNDVIQLVSFDELEKEKQFLQYLRTSNEYLGK
KQIIGLCKIAAFCEDNTLVETKQADMRKECLAYWKLPDESRTIPKHMKPKDKLNILVKDS
TFLSNFATTLKVDNINNLLNSPYDWFCMPCSTKLQPDDERKNATFYMSMGRSNVYRYLKY
GWVEVSDINIELPSNTLVYAEVVHEMKREFRHQQKVLALHIIDAFILGGEDVSQKYLRER
HELTKKFCEALWKPEGSNYARVRAKELFPVNSDICEKLQIKVYELPETSLHYDQNCDDKL
YFIPNSIIFLRSTVNPWNRYVSKTHRTTYVFNYKTNENLFDKNRPRSAEANFIESFKNRV
IWYWPSDKSLTMNIFAKFIKDKCNIT
Download sequence
Identical sequences ENSAPMP00000012542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]