SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000017427 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000017427
Domain Number 1 Region: 2-50
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000233
Family Centromere-binding 0.018
Further Details:      
 
Weak hits

Sequence:  ENSAPMP00000017427
Domain Number - Region: 153-209
Classification Level Classification E-value
Superfamily X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal domain 0.0314
Family X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000017427
Sequence length 282
Comment pep:novel group:AMEL2.0:Group3:11215219:11218402:-1 gene:ENSAPMG00000016569 transcript:ENSAPMT00000017425
Sequence
FEWACREHAMNNFFDKHMLREKALELTKKYGVNGFRCSDKWLNNFLHDHGFSIDLSNIIF
TDYHKWIDLMRSTIIKYRHKDFFHADELTMYSDVFPSEILYNDAKNPNLDNAPRNKIIIL
MSCNSTGTTKLPLLICGPYPSKITMKEHIYCHNKNSHIGNELFRNWLSNVNDYMIKCNRK
ILLFLQRNRMRALKDFVASNIQLVYFPEDFPSFLRPLRRDVFHYVKMVFRRSDIACYLTY
AEQLKDITEWNLHDILTSLIEAWETIPRELIIFSFQRTRFRT
Download sequence
Identical sequences ENSAPMP00000017427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]