SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000017991 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000017991
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily Homeodomain-like 6.84e-23
Family Homeodomain 0.0000721
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000017991
Sequence length 90
Comment pep:novel group:AMEL2.0:Group5:9365903:9381629:-1 gene:ENSAPMG00000002304 transcript:ENSAPMT00000017990
Sequence
QRRKRRVLFTQQQVHELERRFKQQKYLSAPEREHLAALIHLTPTQVKIWFQNHRYKCKRQ
AKEKAMAEQNAQNQRVFRPASTSPFHRISM
Download sequence
Identical sequences ENSAPMP00000017991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]