SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000029786 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000029786
Domain Number 1 Region: 47-234
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.01e-27
Family RNA methyltransferase FtsJ 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000029786
Sequence length 258
Comment pep:novel group:AMEL2.0:GroupUn:18264712:18266270:-1 gene:ENSAPMG00000016158 transcript:ENSAPMT00000029788
Sequence
LIIRNLHTYSTLFRETPQNLKGKKHSSQLWLTRQIEDPYVELAKRENYRCRSAYKLLEIN
ERFKILEPGKIVIDCGAAPGSWTQVAVKLTNANAKQKSAIGTVLGIDKQPIYPIEGATLL
SGMDFMAATSQNKILNILNGRKVNVFLSDMAPNASGIRDLDHENIMKLVYSALKFALQII
HINGIFVCKLWDGKKSLQLEKDLTRFFKYVKNIRPKATRDESTEKFLIAREFKGIKIKKI
TGRDVKFKNDFASREKHY
Download sequence
Identical sequences ENSAPMP00000029786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]