SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000001374 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000001374
Domain Number 1 Region: 153-218
Classification Level Classification E-value
Superfamily Homeodomain-like 8.13e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 49-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000385
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 17-47
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000143
Family LIM domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSAPMP00000001374
Domain Number - Region: 109-139
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0285
Family LIM domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000001374
Sequence length 382
Comment pep:novel group:AMEL2.0:Group16:496989:507392:1 gene:ENSAPMG00000000817 transcript:ENSAPMT00000001374
Sequence
EFRFLPWNILNAFPFLASIPKCGGCQEAILDKYVLRVLERCWHARCLTCRDCGARLTDKC
FARNGHVFCKDDFFKRFGTKCAGCGQGLAPSQVVRRAQELIYHLTCFSCALCSRQLDTGD
EFYLMEDRKLVCKPDYEQAKAKELADGGSIDGDQPNKRPRTTITAKQLETLKLAYNTSPK
PARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRSMKGTGAGGHSP
RHDKLLEKDELKVDLDSTFGHHDLSNDSYGTVVNMGLDGEGASPGGGGNGAGGGPPRGYL
GATTPPYLSTSRSPSLPPQFPYPPDAGLSVYTTLGKKRHIFSTGNRGAGGMVPGPASDLS
NESSSSARYRSCPRNPRSSTSP
Download sequence
Identical sequences ENSAPMP00000001374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]