SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000003240 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000003240
Domain Number 1 Region: 5-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.49e-75
Family BAR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 391-570
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00000226
Further Details:      
 
Domain Number 3 Region: 266-366
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-18
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 
Domain Number 4 Region: 742-798
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000184
Family SH3-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000003240
Sequence length 799
Comment pep:novel group:AMEL2.0:GroupUn:176254896:176262060:1 gene:ENSAPMG00000001889 transcript:ENSAPMT00000003240
Sequence
IGLKPLEFTDCLTDSPYFRENLHYHERELEKTSQQIKRLIKEVKDLLIAAKKLSRAQRAF
SKTLQNFSFECIGETQTEDETHISQSLKEFGKLIASIEDERDRMLERAYDQIILPLENFR
KEHIGGVKDGKKKFEKQTIKFCQSQERYLNLSTKKQDNVLQEADATLEMAERHFCQASLE
YVFLLQEVQERKKFEFVETLLGFMFGWLTFYHQGHEVAKDFKPYMTELQLKIQKTRENFL
ATRDKTESLMNKMKESAVETGVNKLFTREGYLFLMEKKAFGTTWTKHYCTYQKDKKEFIM
IPYNQLTGKFESSKEVLTLASCVRRMSDTIEKRFCFDITTVDKHNVVYTFQALSEEDRKL
WLDAMDGKEPVTNVSASTKSEETILDETGFMFVSKCIAILEERGLEVQGLYRVVGVASKV
NKLLAMGLDRRKLEKLNLDNRLEWESKTITSALKTYLRTLSEPLMTFRYYNSFISAAKQE
IKEARINDIHNLVYRLPKANFNMLVLLIKHLYSVAKKSDKNLMTIGNLAVCFGPSLLRPE
EETVASIMDIKFYNIVVEILIENCERIVAGPPQDTVCNISSTQNAISSRSRTEDASTSCG
NGTPFLRYPIHSNISSPHGHLVTRSYYDSPLTSIDDLKLGDYEETEHMNHRMLTYLSRSG
RVNANLMYSADKNLVLTSGNTSSSSESIASDPHSFSSDLPVKQKRSSMMLIPRLLVDVQA
LDKYLVFGKHKILVKHHYVIYYRRVRTLYACVAESDGELSFEPNQIITNAVKASLEPGWL
EGTLNGKTGLVPKNYVEQL
Download sequence
Identical sequences ENSAPMP00000003240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]