SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000004427 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000004427
Domain Number 1 Region: 23-261
Classification Level Classification E-value
Superfamily L domain-like 4.65e-41
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 255-354
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000096
Family C1 set domains (antibody constant domain-like) 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000004427
Sequence length 573
Comment pep:known group:AMEL2.0:GroupUn:30053725:30055494:-1 gene:ENSAPMG00000002526 transcript:ENSAPMT00000004427
Sequence
TLALLSKAAAFPDWTDCPAVCRCKWTSGKKSALCPDAGLTSLPASLDPDMQVLDLSGNKI
PALQSEIFKRSGLLNLQRVFLRNAGIHKIHADSFRDMRILVEIDLSDNHVEMLEPDTFLG
NERLRILILSGNPLTRLRSHQFPLLQHLRNLELQRCSLSEIHGEAFVYLTGLESLRLDKN
VLEYLDVSVISNLPRLKTLTLDGNRWSCDCRLRDFRTWLIPNGPSKLYSVPQACSSPMRL
EGRKWEDVKPVEFACEPEVFVLASSIQEETNGNLSLACLATGDPEPEVWWQLNGGPVNAT
KLTEQIYTGTYVAYATLVDRWNNLTVYNASDGDAGEYSCFAKNIAGLARDTVSVAIPRVY
TAPTLSQSDNWLLWVSLAGGGAAALCASISAVLLALCVCGGTRRQTAREKVKLQSSTSFG
DQEKKLLDLSVTTTTTPGNSNDRGSGHGSIVEGCSTGDLELAERGSICDPMSAATVTVER
LRPEMSGGPAMRTVPCVFPPPPPEFTSGVLPPGIFGNIFISVAVPQDASDRCYPDLLDIP
VHATGGAAGKTALPPASSVSSFATLPRRALRSS
Download sequence
Identical sequences ENSAPMP00000004427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]