SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000008732 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000008732
Domain Number 1 Region: 175-266
Classification Level Classification E-value
Superfamily Immunoglobulin 3.21e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 23-59,86-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000541
Family V set domains (antibody variable domain-like) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000008732
Sequence length 269
Comment pep:novel group:AMEL2.0:Group1:20716591:20743207:-1 gene:ENSAPMG00000009490 transcript:ENSAPMT00000008732
Sequence
VAWIHVGRQMLLTIHKHVVVKIPRFSVSHDNQKTWLLHINNVQQDDRGYYMCQLNTNPMM
SQVGFLQVVVCTQVPPNILDSLSTESTVAVRENQNITLTCKADGYPTPKLMWKREDGQNI
NINRHKKGERTRLVLDDSLRWKDERHLLGGRVSRERNIVPPDALMAGGLIATISPMIFVP
NQLVGAPAGTNVTIDCHTEAYPRAMSYWFLGDEMILSNEKYTTSIMENSYRAYMRLTIRN
LQAGDFGNYRCISKNSLGETEGSIRLYGK
Download sequence
Identical sequences ENSAPMP00000008732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]