SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000009049 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000009049
Domain Number 1 Region: 3-300
Classification Level Classification E-value
Superfamily L domain-like 1.02e-61
Family Leucine rich effector protein YopM 0.077
Further Details:      
 
Domain Number 2 Region: 585-687
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-26
Family PDZ domain 0.0007
Further Details:      
 
Domain Number 3 Region: 952-1050
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-24
Family PDZ domain 0.00025
Further Details:      
 
Domain Number 4 Region: 708-808
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-24
Family PDZ domain 0.0031
Further Details:      
 
Domain Number 5 Region: 861-952
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-22
Family PDZ domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000009049
Sequence length 1108
Comment pep:known group:AMEL2.0:Group4:9830089:9838641:1 gene:ENSAPMG00000005232 transcript:ENSAPMT00000009049
Sequence
IPDIPENIKNLRALQVADFSSNPIPRLPAGFVQLRNLTVLGLNDMSLTNLPPDFGSLEAL
QSLELRENLLKSLPESLSQLYKLERLDLGDNDIEVLPAHIGELPALQELWLDHNQLQHLP
PEIGELKTLVCLDVSENRLEDLPEEIGGLESLTDLHLSQNVIEKLPDGLGELKKLTILKV
DQNRLSTLNPNIGRCENLQELILTENFLLELPVSIGKLLNLNNLNVDRNSLQSLPTETGR
NLKQLGVLSLRDNKLQYLPIEVGQCTALHVLDVSGNRLQYLPYSLINLNLKAVWLSKNQA
QPMLTFQTDVDEETGQEILTCFLLPQLEIHPDGRLGMLAGMRNAVQDGEIRELGSSDDEG
WQEKEASNEPPETDKETPFVRQNTPHPKELKAKAHKLFSKGKNDSRSASTDEQDVSQTFG
LDKTETDSTKPNDLTADLVEQESLKHESVENEQKEIVPGVVTDNTDVQPSNEPEIVSNQY
IIESNTVLRTEGSISESKDRNDKEEDESENEETQRHVEFSIAEGTDYDGSGDSNRPNRLH
RRDTPHHLKNKRIHPAVDKEKVASIIAQEKKKRGIKIDAISDAEPTIEVREEQYEIHIER
TTGGLGLSIAGGIGSTPFKGDDEGIFISRVTEGGPADLAGLKVEDKVLSVNGVSVVNVGH
YDAVEVLKACGRVLVLVVQREVTRIVPPFEQMLLSKKIPEPISSTKIGNEPMVSVLVHTT
LIRDQNGLGFSIAGGEGSPPFKDNSDAIYISRITDGGVAQKDGKLLVGDKVISINGVEMR
GAKHEQAVALLTGLERFVRLVVEREIPFSQPDNLPGDVNFPPAPTTLGKVTETITKSTLT
ETVVTRVTENQLVPPVIIEDVILIKEGSLGFSIIGGTDHSCTPFGAKEPGIFISHVVVPG
GIAAKSGKLRMGDRILKVNGTDVTKATHQEAVMELLRPGDQIVLTVQHDPLPENYQELVI
TKEPGEKLGMHIKGGLRGQKGNPLDHTDEGVFISKINSGGAAKRDGRLKVGMRLLEVNGT
SLLGATHQEAVNILRCSGNTITLVVCKGYDKSEIEPVLPISDDATTEGTKSLSQSISSLD
RDDEEAATLRQEQEMKAELVAWEQEERE
Download sequence
Identical sequences ENSAPMP00000009049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]