SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000011893 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000011893
Domain Number 1 Region: 1984-2002,3054-3229
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.85e-38
Family Laminin G-like module 0.00063
Further Details:      
 
Domain Number 2 Region: 3294-3483
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.08e-34
Family Laminin G-like module 0.00089
Further Details:      
 
Domain Number 3 Region: 3522-3724
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.55e-34
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 2113-2198
Classification Level Classification E-value
Superfamily Immunoglobulin 7.55e-17
Family I set domains 0.016
Further Details:      
 
Domain Number 5 Region: 2469-2569
Classification Level Classification E-value
Superfamily Immunoglobulin 3.93e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 2386-2484
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000151
Family I set domains 0.02
Further Details:      
 
Domain Number 7 Region: 2776-2852
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000153
Family I set domains 0.071
Further Details:      
 
Domain Number 8 Region: 885-970
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000278
Family I set domains 0.029
Further Details:      
 
Domain Number 9 Region: 2676-2752
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000126
Family I set domains 0.032
Further Details:      
 
Domain Number 10 Region: 2299-2388
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000175
Family I set domains 0.02
Further Details:      
 
Domain Number 11 Region: 2022-2108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000405
Family V set domains (antibody variable domain-like) 0.07
Further Details:      
 
Domain Number 12 Region: 2887-2961
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000623
Family I set domains 0.012
Further Details:      
 
Domain Number 13 Region: 2213-2296
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000106
Family I set domains 0.017
Further Details:      
 
Domain Number 14 Region: 801-841
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000367
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 15 Region: 2972-3053
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000439
Family I set domains 0.023
Further Details:      
 
Domain Number 16 Region: 652-735
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000692
Family I set domains 0.025
Further Details:      
 
Domain Number 17 Region: 3223-3301,3504-3542
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000549
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 18 Region: 764-802
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 19 Region: 849-889
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 20 Region: 83-121
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 21 Region: 367-407
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 22 Region: 35-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 23 Region: 446-485
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 24 Region: 1215-1373,1586-1605
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000408
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 25 Region: 139-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 26 Region: 593-631
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 27 Region: 320-358
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000785
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 28 Region: 522-560
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 29 Region: 259-294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000982
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 30 Region: 407-442
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 31 Region: 219-258
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 32 Region: 1620-1664
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000865
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 33 Region: 2599-2680
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000909
Family I set domains 0.024
Further Details:      
 
Domain Number 34 Region: 1-33
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSAPMP00000011893
Domain Number - Region: 185-215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00034
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number - Region: 1926-1967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family Laminin-type module 0.075
Further Details:      
 
Domain Number - Region: 1675-1726
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00809
Family Laminin-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000011893
Sequence length 3725
Comment pep:novel group:AMEL2.0:Group8:4847425:4895934:-1 gene:ENSAPMG00000006837 transcript:ENSAPMT00000011893
Sequence
QFKCRNEQCVDSSARCNGVNDCSDHSDEDDQVCKACGKDQFECTPGVCISKSKQCDGVMD
CNNGKDEENCRKHMMLFSVPRLVVRCRSDEFECLDGSCVSQTARCDGRSDCRDRSDEYNC
TDWTVETYHNDPNSKDFSTGCGATEFRCTDGRCIGYELQCNGVEECSDGSDERDCGNYAI
HTILHTCYCDGTCIEKDKVCDGVMDCEGSTDEFNCDLAPCPSMDFTCSDGSCILKSSVCD
GFDDCPRAEDELHCGRRECDPSKEMRCDDGQCILLRRKCDNIFDCLDGSDERGCGKTPLC
FRFESLEQFLPFSKYILFFSSSVCSPAEWKCASGECIAEIERCDNVIHCADGSDESGCEN
FYSIYFQISECPAGMFRCNDGLCLDNKRRCDGRPQCSDGSDEINCQCPDGQLPCDNKVCI
NKNFFCDNNIDCHDGSDERDCNNAVTQPPRCREDEFTCRDGTCIPQSALCDERPDCPYAE
DEANCLQGKNTSDRTNLVGLIHETRDNKDYNPDYQAPANHSTPRSCAPDDFVCADGTCIP
ETHHCDHFYDCRDFTDEQYCFDLDDLLASISLRLILFLNTISSTPIVKLNSIRCGKDQFQ
CADGNCIRIEDQCNGYIDCADGTDEDDCGKYNILVIYIIVSSTEPSSLSLKTYPSEQVIK
ESREVVFQCRDEGPLRAKVRWLRGNNLPLPSGSRDINGRLEIPNIQLNHSGSYICEAVDY
PPSTPGQQVSVYLTVEKCILKNYIKHKINHLFIFHVVDPPATSRPHVCQYDEATCSNGEC
IPKSYVCNDRLDCTDGSDEMRCSPHGCEPNQFRCNNTQCVSKLWRCDGDKDCADGSDEEN
CAPNKPGSPCRFTEFACASNNQCIPKSYHCDMEKDCLDASDEVGCSPVFIVKPPVPMITL
NIGEVLTITCTAIGVPTPEINWRLNWGHVPPKCTMTSINGTGTLTCPNIQPEDQGAYSCE
GLNNAGFVFAIPDAIVMVNKSMRDICPKGMFNSEARNPDECISCFCFGVATECHSANLFT
YHIPPPMDRHNIIEVKFQPNIQILNDITGQISILRSIDRNGVQLYQQDLLSNTDKELPYF
ALPETYYGNQLKSYGGYLKYRVRFNGTGVANSAPSVILSGNNYRLVHRGKQLIPNYDNEE
IVRFFQGEWYKQQGWNEIPATREDIMMTLENVDNILIKAQYDNSPYLDIRITNIVMDTAD
VRNTGLGSASYVEECECPSGYSGLSCEQCAPGYLRRQSGPWLGQCYRDEPPCSSGYYGDP
SRNIPCQMCPCPLTNPSNQFARTCQLGSDGQPTCNCPPGYIGRRCEQCDVGYQGNPLIPG
DMCVPISHCDPDGSLSLVADPITGRCRCKLYATGLTCNQCKANTFNLATKNQFGCISCFC
MGITNKCVSSNWYRNDIRVSFTNSIRDFSLIESKSPDTLPIVNGIRLDAVNREIIYSDFP
NRGNNDVYYWQLPSIFLGDQITSYGGNLKYTVRYVPSPGGQSSKNNAADVELISANDINL
LYFSREFPEPNTPQTFTVPLLEQYWQRNDGTQADREHLLMALADIRAIKIKATYTTHTDE
AALSLVSLDTAEKYNTGKIRAVEVEECTCPVGYKGLSCEDCDVGYTRASEGLYLGICEPC
NCNGHSNQCNPDTGVCENCAHHTTGDFCDICESGYEGDATRGTPYDCTYSTERPCMCNEL
GSRSSVCIGNTCDCKRNVEGSQCNRCRSGTFGLSAENPNGCNECYCSGLTDQCHESSLYV
QQIPMWVYDNQHGFTLTDSSRQEIIDDGFELNLATNEIGYRYPDSRGRRLFWSLPAIFTG
NKVKSYGGNLTLTQHITAYSGAQSYKDQDIILIGNGITLFWTNPTEIQPDIPLTYSVPFR
ESEWKRLTTEGPRVTSRIDLMTVLSNLEAILVRATHSEWMTATYISDISLDTAVEHQTGN
KRAIQVEVCRCPTGYVGTSCESCARGYYRDTNDRSVSYLGSCILCPCNNNEESCEMTRIG
QVKCHCQPGYVGQYCQDTVTEGTTIPTTPFTTITPPMILIYIRGPEFQIIETGTTVRYHC
SGTSVDNGSLYIKWEKEGGQLPPGRSVDDNHGLLVIRDVKVSDSGIYVCQVSDGVHIGYK
NVTLTVGGKKETAPRTIVIPPSLQVVEGHSAEFRCEASGNPPPQIEWIRVHGPMNPEVIV
YNGAWILKAVSKSDAAEYKCIARNNIGVDERTVILYVKYNNETPPSHSIPPTITPPQWIG
SVGDTIVITCIPSLDANVTWTRERNIPLPPTANQRDGILTIVNPSTYDSGIYKCTTINYI
GTVAQKTINITVTPRKPLPTVKVTPEKQTVPQGSIAEVKCFTTGEPGVQVKWSKYLEQMS
PNVQQIGDTLRIVNIQIADRGVYVCRVTGSSGSHEASAIIEVEPREPPLVEIYPKNVPPV
ILGGSTDLQCRAIAGIPIPVLQWSHEDGRPFASNIKHLPGGVLRLSNITTNDGGSYVCSA
VNSVGSNSATVYIEVQSVPIILITPKSGILTVKPGDRVRLVCSATGYPQPTVAWSKHMNI
VPLTNEVIDTPQKAVYEIYSASPNDEGSYTCHANNAAGIVEERVYIRVEDSEVYPPCRGD
VPCHDTTSDDPIPKDYLRIPNGGKVEMRCHVHDNDGNHIYLDWKRTDHRALPNGSSVHNG
VLIIPAVDKSAAGEYVCSGMDQAGNLLFKAKSHLEVLSPPRIVLIPPRQTVRSGESPSIE
CRTNGDEPMTIEWNAIGRSLPYSVTHNRGLLQFHGITYSDAGKYVCKATNDXVHRSMQLA
IFPEHPYENTEVKATQRDIVTYIGQPVRLQCMVREKATIHWVRDGQPLPSNVRIEEDYLE
LPRVRPEDSGRYICQIQTSHGVSSDYINLNVSLITATSTANGGFTTIFKIEAVCFEKNYV
FPMCNDPVNIGDTIDIRCACSGTHNPRYHWSRPNHMSLPENAQEYGNVLRLSNVAVSDSG
LYRCTADTPEGVFKQDFNLVVHGGNNDAPAIETKYAPYGSSLEMDCRPNIDPPMKFHWSK
LGGFLPPDAQIFESKLKLINVKAEDAGTYICSVNNNHENIEIPTVLVVTGVVPYFSQAPR
SFIALSPLRDSYLKFNIEISFKPQSYDGIILYNDESSSGNGDFVLLSLVRGYPQFSFNLG
SGPAIIRADKSVTLGEWHTIKLQRNRKEGTMLVDGEGPYKGVAVGKKQGLDLKALLFIGG
VPSDNIITQYAEINSGFVGCISRLIIGEKEIDLIGDQTDSVGITNCETCAENPCNNGGVC
QEAATKNGYLCLCRAGYSGKHCDYIGQSCYPVGACGEGNCVNKETGFECYCPPGRTGPRC
ENSIKIYEPAFYDDKSFIAHETPKALRRLKVALNFNPLDNEDGILMYCAQSDEGLGDFVA
LIIKEKRVEFRYDIGSGPAIITSNHILQPGVWTHVSINRDFKEGNLTVNGEPTVIGKSPG
SDRIMTLNTPLYIGGIDRRKITINKNAGVNKTFRGCISDLGVSSVNVDILKSAIDSANID
DCNVLHPNQIKITTVITTTSSTTTPYNPCASNPCINGGTCTDLHGSYKCDCQLGYNGQNC
EKLAEITYDVAFKGDGWLELDKNVMIHEEEREVLGFEISTNKTRGLIMWHGQMPNNLNPD
HYMALAVVDGYVEYQYDLGTGPVVIRVTAQKVDDGERHRIILKRQGSDGSIELNGEHMES
STSYGTQQDLNTKGNVYLGGVPDYAMTYGKYQEGFSGCIYTMEVQDSGAIDIGDKAIRGK
NVSPC
Download sequence
Identical sequences ENSAPMP00000011893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]