SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000011901 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000011901
Domain Number 1 Region: 1889-1907,2959-3134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.73e-38
Family Laminin G-like module 0.00063
Further Details:      
 
Domain Number 2 Region: 3199-3388
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.08e-34
Family Laminin G-like module 0.00089
Further Details:      
 
Domain Number 3 Region: 3427-3629
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.34e-34
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 2018-2103
Classification Level Classification E-value
Superfamily Immunoglobulin 7.27e-17
Family I set domains 0.016
Further Details:      
 
Domain Number 5 Region: 2374-2474
Classification Level Classification E-value
Superfamily Immunoglobulin 3.79e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 2291-2389
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000151
Family I set domains 0.02
Further Details:      
 
Domain Number 7 Region: 2681-2757
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000153
Family I set domains 0.071
Further Details:      
 
Domain Number 8 Region: 790-875
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000278
Family I set domains 0.029
Further Details:      
 
Domain Number 9 Region: 2581-2657
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000122
Family I set domains 0.032
Further Details:      
 
Domain Number 10 Region: 2204-2293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000171
Family I set domains 0.02
Further Details:      
 
Domain Number 11 Region: 1927-2013
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000405
Family V set domains (antibody variable domain-like) 0.07
Further Details:      
 
Domain Number 12 Region: 2792-2866
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000609
Family I set domains 0.012
Further Details:      
 
Domain Number 13 Region: 2118-2201
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000109
Family I set domains 0.017
Further Details:      
 
Domain Number 14 Region: 706-746
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000353
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 15 Region: 2877-2958
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000422
Family I set domains 0.023
Further Details:      
 
Domain Number 16 Region: 3128-3206,3409-3447
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000518
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 17 Region: 669-707
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 18 Region: 754-794
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 19 Region: 83-121
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000013
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 20 Region: 367-407
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 21 Region: 35-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 22 Region: 446-485
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 23 Region: 139-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 24 Region: 593-631
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 25 Region: 320-358
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000759
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 26 Region: 522-560
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 27 Region: 1120-1278,1491-1510
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000722
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 28 Region: 259-294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000956
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 29 Region: 407-442
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 30 Region: 219-258
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 31 Region: 1525-1569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 32 Region: 2504-2585
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000884
Family I set domains 0.024
Further Details:      
 
Domain Number 33 Region: 1-33
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSAPMP00000011901
Domain Number - Region: 185-215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000327
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number - Region: 1831-1872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00414
Family Laminin-type module 0.075
Further Details:      
 
Domain Number - Region: 1580-1631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00781
Family Laminin-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000011901
Sequence length 3630
Comment pep:novel group:AMEL2.0:Group8:4847425:4895934:-1 gene:ENSAPMG00000006837 transcript:ENSAPMT00000011901
Sequence
QFKCRNEQCVDSSARCNGVNDCSDHSDEDDQVCKACGKDQFECTPGVCISKSKQCDGVMD
CNNGKDEENCRKHMMLFSVPRLVVRCRSDEFECLDGSCVSQTARCDGRSDCRDRSDEYNC
TDWTVETYHNDPNSKDFSTGCGATEFRCTDGRCIGYELQCNGVEECSDGSDERDCGNYAI
HTILHTCYCDGTCIEKDKVCDGVMDCEGSTDEFNCDLAPCPSMDFTCSDGSCILKSSVCD
GFDDCPRAEDELHCGRRECDPSKEMRCDDGQCILLRRKCDNIFDCLDGSDERGCGKTPLC
FRFESLEQFLPFSKYILFFSSSVCSPAEWKCASGECIAEIERCDNVIHCADGSDESGCEN
FYSIYFQISECPAGMFRCNDGLCLDNKRRCDGRPQCSDGSDEINCQCPDGQLPCDNKVCI
NKNFFCDNNIDCHDGSDERDCNNAVTQPPRCREDEFTCRDGTCIPQSALCDERPDCPYAE
DEANCLQGKNTSDRTNLVGLIHETRDNKDYNPDYQAPANHSTPRSCAPDDFVCADGTCIP
ETHHCDHFYDCRDFTDEQYCFDLDDLLASISLRLILFLNTISSTPIVKLNSIRCGKDQFQ
CADGNCIRIEDQCNGYIDCADGTDEDDCGKYNILVIYIIVSSTEPSSLSLKTYPSEQVIK
EIDPPATSRPHVCQYDEATCSNGECIPKSYVCNDRLDCTDGSDEMRCSPHGCEPNQFRCN
NTQCVSKLWRCDGDKDCADGSDEENCAPNKPGSPCRFTEFACASNNQCIPKSYHCDMEKD
CLDASDEVGCSPVFIVKPPVPMITLNIGEVLTITCTAIGVPTPEINWRLNWGHVPPKCTM
TSINGTGTLTCPNIQPEDQGAYSCEGLNNAGFVFAIPDAIVMVNKSMRDICPKGMFNSEA
RNPDECISCFCFGVATECHSANLFTYHIPPPMDRHNIIEVKFQPNIQILNDITGQISILR
SIDRNGVQLYQQDLLSNTDKELPYFALPETYYGNQLKSYGGYLKYRVRFNGTGVANSAPS
VILSGNNYRLVHRGKQLIPNYDNEEIVRFFQGEWYKQQGWNEIPATREDIMMTLENVDNI
LIKAQYDNSPYLDIRITNIVMDTADVRNTGLGSASYVEECECPSGYSGLSCEQCAPGYLR
RQSGPWLGQCYRDEPPCSSGYYGDPSRNIPCQMCPCPLTNPSNQFARTCQLGSDGQPTCN
CPPGYIGRRCEQCDVGYQGNPLIPGDMCVPISHCDPDGSLSLVADPITGRCRCKLYATGL
TCNQCKANTFNLATKNQFGCISCFCMGITNKCVSSNWYRNDIRVSFTNSIRDFSLIESKS
PDTLPIVNGIRLDAVNREIIYSDFPNRGNNDVYYWQLPSIFLGDQITSYGGNLKYTVRYV
PSPGGQSSKNNAADVELISANDINLLYFSREFPEPNTPQTFTVPLLEQYWQRNDGTQADR
EHLLMALADIRAIKIKATYTTHTDEAALSLVSLDTAEKYNTGKIRAVEVEECTCPVGYKG
LSCEDCDVGYTRASEGLYLGICEPCNCNGHSNQCNPDTGVCENCAHHTTGDFCDICESGY
EGDATRGTPYDCTYSTERPCMCNELGSRSSVCIGNTCDCKRNVEGSQCNRCRSGTFGLSA
ENPNGCNECYCSGLTDQCHESSLYVQQIPMWVYDNQHGFTLTDSSRQEIIDDGFELNLAT
NEIGYRYPDSRGRRLFWSLPAIFTGNKVKSYGGNLTLTQHITAYSGAQSYKDQDIILIGN
GITLFWTNPTEIQPDIPLTYSVPFRESEWKRLTTEGPRVTSRIDLMTVLSNLEAILVRAT
HSEWMTATYISDISLDTAVEHQTGNKRAIQVEVCRCPTGYVGTSCESCARGYYRDTNDRS
VSYLGSCILCPCNNNEESCEMTRIGQVKCHCQPGYVGQYCQDTVTEGTTIPTTPFTTITP
PMILIYIRGPEFQIIETGTTVRYHCSGTSVDNGSLYIKWEKEGGQLPPGRSVDDNHGLLV
IRDVKVSDSGIYVCQVSDGVHIGYKNVTLTVGGKKETAPRTIVIPPSLQVVEGHSAEFRC
EASGNPPPQIEWIRVHGPMNPEVIVYNGAWILKAVSKSDAAEYKCIARNNIGVDERTVIL
YVKYNNETPPSHSIPPTITPPQWIGSVGDTIVITCIPSLDANVTWTRERNIPLPPTANQR
DGILTIVNPSTYDSGIYKCTTINYIGTVAQKTINITVTPRKPLPTVKVTPEKQTVPQGSI
AEVKCFTTGEPGVQVKWSKYLEQMSPNVQQIGDTLRIVNIQIADRGVYVCRVTGSSGSHE
ASAIIEVEPREPPLVEIYPKNVPPVILGGSTDLQCRAIAGIPIPVLQWSHEDGRPFASNI
KHLPGGVLRLSNITTNDGGSYVCSAVNSVGSNSATVYIEVQSVPIILITPKSGILTVKPG
DRVRLVCSATGYPQPTVAWSKHMNIVPLTNEVIDTPQKAVYEIYSASPNDEGSYTCHANN
AAGIVEERVYIRVEDSEVYPPCRGDVPCHDTTSDDPIPKDYLRIPNGGKVEMRCHVHDND
GNHIYLDWKRTDHRALPNGSSVHNGVLIIPAVDKSAAGEYVCSGMDQAGNLLFKAKSHLE
VLSPPRIVLIPPRQTVRSGESPSIECRTNGDEPMTIEWNAIGRSLPYSVTHNRGLLQFHG
ITYSDAGKYVCKATNDXVHRSMQLAIFPEHPYENTEVKATQRDIVTYIGQPVRLQCMVRE
KATIHWVRDGQPLPSNVRIEEDYLELPRVRPEDSGRYICQIQTSHGVSSDYINLNVSLIT
ATSTANGGFTTIFKIEAVCFEKNYVFPMCNDPVNIGDTIDIRCACSGTHNPRYHWSRPNH
MSLPENAQEYGNVLRLSNVAVSDSGLYRCTADTPEGVFKQDFNLVVHGGNNDAPAIETKY
APYGSSLEMDCRPNIDPPMKFHWSKLGGFLPPDAQIFESKLKLINVKAEDAGTYICSVNN
NHENIEIPTVLVVTGVVPYFSQAPRSFIALSPLRDSYLKFNIEISFKPQSYDGIILYNDE
SSSGNGDFVLLSLVRGYPQFSFNLGSGPAIIRADKSVTLGEWHTIKLQRNRKEGTMLVDG
EGPYKGVAVGKKQGLDLKALLFIGGVPSDNIITQYAEINSGFVGCISRLIIGEKEIDLIG
DQTDSVGITNCETCAENPCNNGGVCQEAATKNGYLCLCRAGYSGKHCDYIGQSCYPVGAC
GEGNCVNKETGFECYCPPGRTGPRCENSIKIYEPAFYDDKSFIAHETPKALRRLKVALNF
NPLDNEDGILMYCAQSDEGLGDFVALIIKEKRVEFRYDIGSGPAIITSNHILQPGVWTHV
SINRDFKEGNLTVNGEPTVIGKSPGSDRIMTLNTPLYIGGIDRRKITINKNAGVNKTFRG
CISDLGVSSVNVDILKSAIDSANIDDCNVLHPNQIKITTVITTTSSTTTPYNPCASNPCI
NGGTCTDLHGSYKCDCQLGYNGQNCEKLAEITYDVAFKGDGWLELDKNVMIHEEEREVLG
FEISTNKTRGLIMWHGQMPNNLNPDHYMALAVVDGYVEYQYDLGTGPVVIRVTAQKVDDG
ERHRIILKRQGSDGSIELNGEHMESSTSYGTQQDLNTKGNVYLGGVPDYAMTYGKYQEGF
SGCIYTMEVQDSGAIDIGDKAIRGKNVSPC
Download sequence
Identical sequences ENSAPMP00000011901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]