SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000015870 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000015870
Domain Number 1 Region: 23-260
Classification Level Classification E-value
Superfamily L domain-like 9.72e-49
Family Ngr ectodomain-like 0.00063
Further Details:      
 
Domain Number 2 Region: 259-366
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-16
Family I set domains 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000015870
Sequence length 417
Comment pep:known group:AMEL2.0:Group11:9243432:9248549:1 gene:ENSAPMG00000009093 transcript:ENSAPMT00000015870
Sequence
TLLGTMMLLSWTSSLVEGCPSMCTCKWKSGKEWVECANRDLKGLPQGAREETQVLDLSNN
HLVSLLPECFHALGLINLQRLYLSRSHISHIASRAFVGLVGLVELDLSENLIEEIPTETF
PSYSNLMKLLLNGNPVREIHRGAFQHLVHLTNLELSQCRIENVEQGAFDGLHQLEWLRLD
GNRLTRVPDLTLPLGGSLRGLTLHNNPWLCDCRLQATQAWLKESAPAAPQESEPVCDSPP
KLRGKQIKEVKLNELACLPQIELQDQIEAYEGDNVTLKCDVYAVPAAKLTWWFNGELCEL
QNENDSASSSAYPRQRGGTNMSSALLLYSVETLNEGTYTCIAENGAGSAEANLSLRVLFQ
ERITVEPPNDHSRSGYVVAVAAGALVGTLFALASLIGSIVFCVRKRRRDRKRNSKAL
Download sequence
Identical sequences ENSAPMP00000015870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]