SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000017425 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000017425
Domain Number 1 Region: 175-241
Classification Level Classification E-value
Superfamily Homeodomain-like 9.84e-21
Family Homeodomain 0.0021
Further Details:      
 
Domain Number 2 Region: 31-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000121
Family LIM domain 0.011
Further Details:      
 
Domain Number 3 Region: 4-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000001
Family LIM domain 0.028
Further Details:      
 
Weak hits

Sequence:  ENSAPMP00000017425
Domain Number - Region: 90-119
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0349
Family LIM domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000017425
Sequence length 412
Comment pep:novel group:AMEL2.0:Group2:3731285:3747394:1 gene:ENSAPMG00000002839 transcript:ENSAPMT00000017423
Sequence
MLLSCAGCEKPIMDQYLLNVLDRAWHVECVRCFDCRTTLQDKCFSREAKLFCREDFFRRY
GTKCSGCLQGISPQDLVRKARDKVFHLNCFTCLVCRKQMSTGELYVLDDNKFVCKQDYLS
GKPLPDTHHVHGHHHGSAPRLSPCSLDGDPETRDSQTENKSPDGGAGGGSGDGGAGSKRR
GPRTTIKAKQLEILKSAFSSTPKPTRHIREQLAKETGLPMRVIQVWFQNKRSKERRLKQL
TSMGRSPFFGGSRKMRGFPLNLNPGALGGEDGPPPGFPYFGAEKFEFGYGGPVAFHHEFF
GAHPPPHPHGPPFSGPGNPGLDPASLAGMAAAVAVTGEYPPPGAGGGPPEFLTGPPGQGP
PAPSGGSPDPSTSLSQQSFSFFPYLSSVSSKSGPIYSRHVPHSPSRNLGFFH
Download sequence
Identical sequences ENSAPMP00000017425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]