SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000023234 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000023234
Domain Number 1 Region: 223-289
Classification Level Classification E-value
Superfamily Homeodomain-like 4.71e-21
Family Homeodomain 0.0026
Further Details:      
 
Domain Number 2 Region: 37-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.61e-16
Family LIM domain 0.014
Further Details:      
 
Domain Number 3 Region: 5-36
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000109
Family LIM domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSAPMP00000023234
Domain Number - Region: 98-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0246
Family LIM domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000023234
Sequence length 339
Comment pep:novel group:AMEL2.0:Group11:4777365:4790116:1 gene:ENSAPMG00000009525 transcript:ENSAPMT00000023230
Sequence
ENNNTDGVLGCGGCGREIAERWYLRAADRAWHCGCLRCCHCRVPLAAELTCFARDGNIYC
KEDYYRLFAGRCSRCRAGISATELVMRARDLVYHVACFTCASCGTPLNKGDYFGQRDGLV
YCRRSTRALVKQGSRMTSWSVPRPHYELLCCAGDYGGAATSIEDIGSPGVSPLPAYYSAA
EQSPITSSGTVQKGRPRKRKLSETELSSSMESLAAYEASVGSPGPVHQSQRTKRMRTSFK
HHQLRTMKNYFAINQNPDAKDLKQLAQKTGLSKRVLQVWFQNARAKWRRNMMRQEGNTTT
SNVGCPGTPVPSNTAGSPNVGPAASILGDSNSMPSTSME
Download sequence
Identical sequences ENSAPMP00000023234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]