SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000025949 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000025949
Domain Number 1 Region: 1-204,231-270
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 1.19e-86
Family Tubulin, GTPase domain 0.00000000158
Further Details:      
 
Domain Number 2 Region: 272-433
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 1.77e-67
Family Tubulin, C-terminal domain 0.0000000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000025949
Sequence length 477
Comment pep:novel group:AMEL2.0:Group4:9475234:9478428:1 gene:ENSAPMG00000014649 transcript:ENSAPMT00000025949
Sequence
RECISIHIGQAGVQMGNACWELYCLEHGIHPNGQMPSDTTVGYGDDSFNTFFSETDSGKH
VPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIAGKEIIDLTLD
RIRRLTERCRGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYPKKSKLTFSIYPAPQVSTA
VVEPYNAILYTHPTLEHCEVAFIVDNQVCNIIQYLYSNRFIITDIKILRISSQAIYELCR
RNLSIDRPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAP
VISAEKAGHERITVAEITNSCFEPNHQMVNCDPRRGKYMAVCMLYRGDVVPKDVNAAIAT
IKRQKHVQFVEWCPTGFKVGINYQPPTVVPGGDLAKVERAVCCLCNTTAIIEAWARIDNK
FDLMYAKRAFVHFQEDATNTDDEEERNKEIDMLEHINNMLIKIPYDKNHLIQKNIVY
Download sequence
Identical sequences ENSAPMP00000025949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]