SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPMP00000030641 from Apis mellifera 38.2d

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPMP00000030641
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000161
Family V set domains (antibody variable domain-like) 0.067
Further Details:      
 
Domain Number 2 Region: 229-314
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000028
Family I set domains 0.083
Further Details:      
 
Weak hits

Sequence:  ENSAPMP00000030641
Domain Number - Region: 134-216
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000568
Family I set domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ENSAPMP00000030641
Sequence length 322
Comment pep:novel group:AMEL2.0:Group5:11315661:11367648:1 gene:ENSAPMG00000016147 transcript:ENSAPMT00000030641
Sequence
MESIQGVAGQRATLPCNIQPREPNDAVSMVLWFKEDSGEPLYSYDARNRQFGKAKLWSAS
HFWGDRATFKASQPAQLTIRDLRETDQGVYRCRVDFRNSPTRNLKVNFTVIGLTFHYRVS
ISSGKINFGSRNFPPFEEGEFFSLLLLRITGKPRPRVTWLLESQTIDAPSEIRESQGPGG
EANVVTISNVTLKGLTRSHYHAKLLCKANNTHLAPPPTTAVVIELHMKPLKVEITGRDKI
LSAGKKYETRCQSTGSKPPAVLTWWKASKQLKRTIRNEDGTSVSVLQWTPSIEDEGKFLV
CRATNPKLQDTGIEERWKLKVH
Download sequence
Identical sequences ENSAPMP00000030641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]