SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CA0295 from Candida albicans SC5314

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CA0295
Domain Number 1 Region: 133-153,204-306
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000179
Family UAS domain 0.034
Further Details:      
 
Domain Number 2 Region: 436-477,514-526
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000568
Family UBX domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CA0295
Sequence length 564
Comment IPF15033 unknown function
Sequence
MSSSISDWIRNFFQPSTSYQRVGTSSNSSIPGSFPTEQESNSPPHPPSSRISPVFNSQTI
NSTFRNLSSWLNYLLIQPLIIIILVIFRILSTIINVIYFQNQSPSIVNGSGGGGGSGSGI
DGSTNNNSRCEFVDPVAKASKFIRDLEDNLQPPSILQGNDINSGGGGSNDTHSPITSATR
PVSGTTVTTTTTTTSTTISNSERLPPFFQGSYTQALYMATKRGKFLFVYLTNPHNENANG
IFNNIITNEIFLKIFRTNENIIIWGGDLTNPEAYQLANSLAVTKFPFLGLLCLTRSSKMT
PEGPRKTVSKLSLVSKIQGNIINTQSLSLGLHQYQNQYQDTNFDDGNLSVANELINRKFL
TKIAKYSPELNLIRQELQDKYMSQILLKQQELNYQKSLQADKLKKQKKQYDTLSKQYLIY
QLDRFEKYLTKDRVANDNIAKIAIKLTNGNRVTGYFPSNNSIEDIFIFVELINRGYLNVA
NNSTTTTTTTTTTKLTSTLTESQALTKFKDFKLIYNFKLLSPLPPKICLNDVLLSSKDTT
PTATTIKINQFDIIYPNGLLIVED
Download sequence
Identical sequences CA0295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]